CAZyme Information: Z517_06702-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_06702-t43_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395		44819.53	6.8171

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846972:2484117-2485508(+)

Full Sequence      

MALYPGDELSNRRIMRQKMCSRLVISLAGLLIFIFPIIIFSHRSVVPSGLLNVGHVRQGV
LDDFEKILVISLPERSDKRDVWALAAAQCDLSISWVDGVKGEDIPIKAIPAGWNMRESNS
TLGCYRGHLNAFQRIISDRLSSALIFEDDAEWDINIKSQLVEFARGLHYLQGVEKPEALH
SPYGDDWDVLWIGYCGAKSRSGDHSYWITHNDPTVVPESLRTETRKEGNRYLDDSAEPLQ
GTFTRVVTEPYNIRCLWAYAVSQRGARRFLYNYSVRAKARTADVAVSEFCSDGVSGARCF
APFPQFVDNYLAAGDTVKDSDRRPFHSEFREEGTSNNIVFPAKTNLGTYINNSRLYQSRW
PDQTLTESINPDTYVFPRGHGVYLSKEHFKTPQNY

Enzyme Prediction     

No EC number prediction in Z517_06702-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	65	273	5.4e-25	0.9281767955801105

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	1.37e-19	66	155	1	98	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
366794	Glyco_transf_25	3.26e-07	64	163	1	109	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
225843	COG3306	4.79e-06	64	270	2	171	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
USW54837.1|GT25	8.34e-73	28	392	14	391
SMR55407.1|GT25	8.64e-68	64	384	58	383
SMY26218.1|GT25	8.64e-68	64	384	58	383
SMQ52585.1|GT25	4.30e-64	70	384	1	320
CAP93867.1|GT25	4.27e-63	64	380	67	382

PDB Hits     

Z517_06702-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8K297|GT251_MOUSE	2.62e-06	64	193	335	463	Procollagen galactosyltransferase 1 OS=Mus musculus OX=10090 GN=Colgalt1 PE=1 SV=2
sp|Q8NBJ5|GT251_HUMAN	6.10e-06	64	193	340	468	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000009	0.000004

TMHMM  Annotations     

Start	End
20	42