CAZyme Information: Z517_06701-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_06701-t43_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		40649.34	6.2373

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846972:2480558-2481616(-)

Full Sequence      

MGSRRFTPCSREVVIAGALLFVVFIFFFSSTSPSKAYHEVINSSFVSSPFATSTKGPVVP
GGTLQRPESKYAYVVYLAPTEKEDAGEEDTEDDVYLTSVRLLIYQLLHDPETRTNNSIPV
VVLVSPQVSQSKRRRLEREGAWIAEFPSIELETVKPDRPRWKHVMDKMNVFRLTQFEKVL
LMDLDIVLFKPLDAIFEEPETDIRDNLGMEDQRKDDEGPQPQRYLLAADSSPIGSDKHPW
PAPRSKALNAGFMVLHPSEEMLAHYLRIGSIDGRTPMLAPENNLLEYVHRLDGNMPYSQI
QHYWVMNHPVFDDYRHGIAAVHEKWWRNSMTDHQLKEMLLKPRWKMEGYWSR

Enzyme Prediction     

No EC number prediction in Z517_06701-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	92	306	1.2e-19	0.7626459143968871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	2.04e-24	95	274	12	158	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	7.19e-15	67	345	52	353	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMR55403.1|GT8	2.18e-64	64	348	32	312
SMR57780.1|GT8	2.18e-64	64	348	32	312
SMY26214.1|GT8	2.18e-64	64	348	32	312
SMY19627.1|GT8	3.93e-64	68	351	63	348
SMR42298.1|GT8	5.54e-64	68	351	63	348

PDB Hits     

Z517_06701-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43062|YGT9_SCHPO	3.71e-17	90	332	86	351	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1
sp|Q09680|YA0C_SCHPO	3.34e-15	64	332	62	346	Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.12c PE=4 SV=1
sp|O43061|MU136_SCHPO	7.20e-13	67	307	53	316	Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug136 PE=1 SV=1
sp|Q5UNW1|YR707_MIMIV	2.48e-06	69	196	2	114	Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R707 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.984934	0.015086

TMHMM  Annotations     

Start	End
13	32