CAZyme Information: Z517_06443-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_06443-t43_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520	KN846972|CGC10	57918.74	4.9736

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846972:1800710-1802272(+)

Full Sequence      

MLSLPCLNIHLFLLVAACLAQEVNYTCPNPVVYFTENHGPFSAGRFNLSYQRPPQHCRTF
NLSEVEDVVSNLKSHISDPDLSRLFENAFPNTLDTAIRWHGFAGNNSQEELTFVITGDIN
AMWLRDSSNQLQSYSSLLKANSSSDSLASLYRGVINLQSRYINTSPHCNSFQPPPESGVE
PAVNGFAATDVVFPPVTNTTVFECKYELDSLAAFLQVSYNYYNATSDLDFFNRFQWVDTV
QTIMNTVLNLTVGTYDSDGRVLDQPYTWNRTANSATESVSNLYRGNPVVGGTGLIRSFFR
PSDDSCIYQLFIPANMMFSHYLGLCADIMQSLQNPVAATLASNMRNLSATIRAAIQAHGI
YHTRGSHRVYAYEVDGYGSYNTMDDANIPSLLSAPFFGYDAATDPVYQATRRLLLSPANS
YYMRGPVLNATDGPHVSFGHAWPMASIVRVLTSGDDDEIRTELRQLVSSTDGLGLIHESV
NSWNASDWTRPWFSWANGLFGQMVLDLAGRKPYLLTESYQ

Enzyme Prediction     

No EC number prediction in Z517_06443-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	78	505	7.2e-152	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	78	505	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	4.60e-138	57	515	2	430	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC91719.1|GH125	9.92e-224	18	520	12	513
AQA29358.1|GH125	8.99e-216	19	520	17	516
UJO14502.1|GH125	8.99e-216	19	520	17	516
QBZ57723.1|GH125	1.51e-208	19	520	54	563
CAE7030360.1|GH125	3.61e-207	27	520	21	514

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	9.34e-76	47	520	38	481	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	1.84e-75	52	520	21	463	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3ON6_A	3.44e-75	47	520	18	461	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	2.38e-65	59	506	2	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
5M7I_A	1.28e-64	59	506	2	421	Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannobiose [Clostridium perfringens str. 13],5M7Y_A Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannotriose [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	2.27e-129	11	518	8	507	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000202	0.999746	CS pos: 20-21. Pr: 0.9721

TMHMM  Annotations     

There is no transmembrane helices in Z517_06443-t43_1-p1.