CAZyme Information: Z517_05527-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_05527-t43_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617		67045.52	5.1015

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846971:4405827-4407860(-)

Full Sequence      

MLSSLLLASLLTLATPSLALDKRQASLSTFIAQEQAIAVQGVLANIGGLNSTLVPDASPG
VVVASPSTVNPNYFYTWTRDSALTYRMLIEELIFGNLTLRKTIEDYTAAQAIVQTVTNPS
GSLWPAGDGLGEPKFYANLTRFDGTWGRPQRDGPALRAITFMELAPVLFNLNETALYKQI
YWPLVLNDLRYVGQYWNRTGFDLWEEVHGSSFFTLANQHRALVQGALLANQLNTTCQPCA
QAPQILCFLQNNFWNATGGYLTANVNVNNAARSGINADPILASISVFDANATCNASDFQP
CNSKMLATHKALVDSFRGLYPINNNSQPPNAVLIGRYPEDTYFGGNPWPLCTLGAAELLY
DAAHQIRNAGQLIVDNFSLPFFTDISPTISLGKYTGDVVNEILTNMTTYADGFVAAVQQF
LPSNGSISEQFDRTTGESTSAFKLTWSFASFITMSRRRAGQFPLSWGASLPLANTDLTSK
QCRGTSFNATGNYTPALAAGAPNITKDCESEVIFSVNATTSFGNNIFVLGNVTKLGGALN
NAGNIILPLNPGNYTPTNPQWYVDLWLKADQTVAYQYVLQDGSQWIFEEHPVRTLRVGAC
GSGRVTRTNDAATFSSS

Enzyme Prediction     

EC	3.2.1.3:94

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	55	454	3.5e-74	0.9501385041551247

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395586	Glyco_hydro_15	9.33e-117	36	456	1	417	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
99886	CBM20_glucoamylase	2.18e-16	512	606	9	101	Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain. Glucoamylases are inverting, exo-acting starch hydrolases that hydrolyze starch and related polysaccharides by releasing the nonreducing end glucose. They are mainly active on alpha-1,4-glycosidic bonds but also have some activity towards 1,6-glycosidic bonds occurring in natural oligosaccharides. The ability of glucoamylases to cleave 1-6-glycosidic binds is called "debranching activity" and is of importance in industrial applications, where complete degradation of starch to glucose is needed. Most glucoamylases are multidomain proteins containing an N-terminal catalytic domain, a C-terminal CBM20 domain, and a highly O-glycosylated linker region that connects the two. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
225922	SGA1	1.53e-12	56	452	258	598	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
395557	CBM_20	2.33e-11	512	603	3	91	Starch binding domain.
119437	CBM20	6.66e-11	512	606	2	93	The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA13257.1|CBM20|GH15	8.66e-196	26	617	31	613
ATZ55778.1|CBM20|GH15	3.27e-190	26	610	31	603
CCD52574.1|CBM20|GH15	4.62e-190	26	610	31	603
CAA47945.1|CBM20|GH15|3.2.1.3	2.50e-187	11	611	18	605
CAA48243.1|CBM20|GH15|3.2.1.3	2.50e-187	11	611	18	605

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FHW_A	8.64e-189	11	611	18	605	Chain A, Glucoamylase P [Amorphotheca resinae],6FHW_B Chain B, Glucoamylase P [Amorphotheca resinae]
6FHV_A	2.16e-156	21	614	2	594	Crystal structure of Penicillium oxalicum Glucoamylase [Penicillium oxalicum 114-2]
6FRV_A	1.39e-151	25	609	1	613	Structure of the catalytic domain of Aspergillus niger Glucoamylase [Aspergillus niger]
2VN4_A	2.33e-148	26	600	1	587	Chain A, GLUCOAMYLASE [Trichoderma reesei],2VN7_A Chain A, GLUCOAMYLASE [Trichoderma reesei]
3EQA_A	3.02e-143	25	504	1	469	Catalytic domain of glucoamylase from aspergillus niger complexed with tris and glycerol [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q03045|AMYG_AMORE	4.44e-188	11	611	18	605	Glucoamylase P OS=Amorphotheca resinae OX=5101 GN=GAMP PE=1 SV=1
sp|P69328|AMYG_ASPNG	5.34e-151	23	609	23	637	Glucoamylase OS=Aspergillus niger OX=5061 GN=GLAA PE=1 SV=1
sp|P69327|AMYG_ASPAW	5.34e-151	23	609	23	637	Glucoamylase OS=Aspergillus awamori OX=105351 GN=GLAA PE=1 SV=1
sp|P22832|AMYG_ASPUS	4.12e-150	23	609	23	636	Glucoamylase OS=Aspergillus usamii OX=186680 GN=glaA PE=3 SV=1
sp|P23176|AMYG_ASPKA	1.84e-148	23	609	23	636	Glucoamylase I OS=Aspergillus kawachii OX=1069201 GN=gaI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000317	0.999678	CS pos: 23-24. Pr: 0.7302

TMHMM  Annotations     

There is no transmembrane helices in Z517_05527-t43_1-p1.