CAZyme Information: Z517_05379-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_05379-t43_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	KN846971|CGC12	42783.93	6.0138

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846971:4012171-4013618(+)

Full Sequence      

MKFFYSPAGFLALGVSLLVTSTTSTAVPRQSSNKPWSLQNFNSLITFGDSYTDESRLGWF
INHNGSAPPVGTLLPETFSAPSGGRNWPRYVVQYTGATVQGQWTPHMTLYDYAVSGAVCS
NDITPRWLPAINAPFPSVLEYEIPAFIADIPATRVNSTPAVQLFSPNLTAQDAVYALWIG
TNDLGVWAFITDSQVPGKVLSDYTSCIYSVFDKLYASGARHFVLMNTAPLDLAPLYANDT
LHGVGANQYWANKPANHTEIAYTMRQFTTTVNNVFKYQTPYELLVAKRYPGAHFALFDTH
ALITDIYNSPTQYLNGTGVAKGGESVWGYENHCTVDQKTCVQRQNGTNPDGYLWFDELHP
SEQTDRIIAQNFVQVLNGTSKYATYY

Enzyme Prediction     

No EC number prediction in Z517_05379-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	44	372	5.3e-68	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.07e-44	43	375	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	2.80e-15	173	374	130	313	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	5.38e-10	10	371	5	328	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	2.13e-09	41	376	1	281	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	7.45e-04	162	369	69	221	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA14322.1|CE16	2.39e-117	12	386	7	357
CCD46398.1|CE16	1.77e-116	5	386	28	387
ATZ51743.1|CE16	2.88e-116	5	386	43	402
APA05712.1|CE16	3.65e-113	5	386	6	365
QMW44554.1|CE16	4.92e-113	11	386	6	353

PDB Hits     

Z517_05379-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	7.31e-90	40	386	26	345	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000209	0.999777	CS pos: 26-27. Pr: 0.9832

TMHMM  Annotations     

There is no transmembrane helices in Z517_05379-t43_1-p1.