CAZyme Information: Z517_04701-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_04701-t43_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		41826.88	4.4839

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846971:2198605-2199842(-)

Full Sequence      

MTSFMSLSLLVLASSFAFCTSQPSPSNGSYDMFWGTSSYYAHGLDEATRNAWLDGLQRDG
ARVIRIWINGISPGTYKGTNITVTIPNLEETVGIFNDTVLDAIDDLFMEGHRRGIKFIVS
VHDGNAFGQNSCDAYCTEFGGFGPASGTPITLGNSFYTDPTAVAAFDNRIAHIMNYQSTN
FGKPWAQLTEAIAAFDIENEPMIQAITQLDTVGPAWFCDRARQFKKYIGSAAIAVSTGGA
GGSGNIYQNWNWRPWLFTCPEIDWIALHGYDGDWTQWVPNATALAAQYNKKLFVEEWGVV
ASARANNLAWNFEKFVELGLSWVYWELVPGPIKSCFCGSDRSNAVFEVQLDGPDYAGFQA
IANRTLTAKSAYDFSAFLAL

Enzyme Prediction     

No EC number prediction in Z517_04701-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	53	308	1.9e-53	0.901060070671378

CDD Domains     

Z517_04701-t43_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7215737.1|GH5	3.74e-57	22	370	27	371
UKZ96195.1|GH5	3.02e-56	33	374	22	358
UKZ69222.1|GH5	6.74e-55	33	374	22	358
UKZ75640.1|GH5	2.98e-53	33	339	22	320
QYS96885.1|GH5	4.39e-53	33	370	22	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PZ9_A	1.12e-10	27	369	23	374	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
6TN6_A	1.74e-10	27	369	9	360	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

Z517_04701-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000351	0.999627	CS pos: 21-22. Pr: 0.6903

TMHMM  Annotations     

There is no transmembrane helices in Z517_04701-t43_1-p1.