CAZyme Information: Z517_04649-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_04649-t43_1-p1
• CAZy Family: GH132
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617		65285.29	4.2370

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846971:2070465-2072412(-)

Full Sequence      

MDRFWVLILLQCTLLAAQSVQNLGVSCIASSQECGPRGGIGDGAHPVLSPQSFITDALIS
TVSNTTRQLASGPAPVRLSASPSSSSSCPPRRHIIIDSANGAQQEMVGFGHAWTDSAVSV
FNTLDNATLSRVLEDLFGQSGNNMGFMRHTIGSSDLSGEQYTYDDNGPSFNEGEPDLDLS
NFSLGPHGTGQAKMIAQMGTVKGDVFLFGSPWSYPGWTKYNDLFIAPNLNVDGGGSYNIL
NNSFNPVYIPQMVEYFSKYVGAFHDMGVQVNGITPMNEPLNYQGGYPCMLLDPVDAASLI
AQGLGQAMHDRGVIIMAYDHNTDQPVYPARVIQGTGGEGSLTDAAAWHCYAGPVANYSVM
SDFHYAFPNTLQFMTECSNYLPQSGSWNFEVAANFIPPVTHGASAAAMWVMATDQDYGPH
SPYGGCAGCQGSVIVNSSTQYTLTNDYYMVGQFSRFVRRGSVNYRILGDGNEGDARQDNQ
FYTMAVRNPDSSWAVVMMNNIGSDQDVVLGFNNGETDVWQGTVPNATVVTWLLPAQGVGA
EPPAPDVSAAPLTNVSVSISVSATATGGEPGGVCPTTSTSSSSSSSSSSTSTLELVPNTT
HTIESPAPTGSNGTATA

Enzyme Prediction     

EC	3.2.1.75:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	94	531	3.8e-96	0.9784172661870504

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	8.83e-23	102	539	43	424	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
307945	Glyco_hydro_30	8.17e-21	108	391	3	273	Glycosyl hydrolase family 30 TIM-barrel domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW96841.1|GH30_3	3.07e-213	35	538	30	513
BCR92989.1|GH30_3	2.62e-98	39	535	19	497
BCS05650.1|GH30_3	2.62e-98	39	535	19	497
QKX59590.1|GH30_3	4.86e-94	95	538	98	526
CAC80492.1|GH30_3|3.2.1.75	5.65e-94	44	535	21	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NGK_A	1.61e-27	104	500	77	460	The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGK_B The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGK_C The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGL_A The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGL_B The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGL_C The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8J0I9|GUN16_TRIHA	1.00e-94	44	535	21	489	Endo-1,6-beta-D-glucanase BGN16.3 OS=Trichoderma harzianum OX=5544 PE=1 SV=1
sp|Q4WBR2|NEG1_ASPFU	5.21e-94	68	535	38	487	Endo-1,6-beta-D-glucanase neg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=neg1 PE=1 SV=1
sp|Q7M4T0|NEG1_NEUCR	4.78e-88	68	537	33	479	Endo-1,6-beta-D-glucanase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=neg-1 PE=1 SV=2
sp|Q9UB00|GLCM4_CAEEL	6.40e-21	104	518	97	497	Putative glucosylceramidase 4 OS=Caenorhabditis elegans OX=6239 GN=gba-4 PE=3 SV=2
sp|G5ECR8|GLCM3_CAEEL	2.33e-15	104	471	102	464	Putative glucosylceramidase 3 OS=Caenorhabditis elegans OX=6239 GN=gba-3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000194	0.999773	CS pos: 19-20. Pr: 0.9553

TMHMM  Annotations     

There is no transmembrane helices in Z517_04649-t43_1-p1.