CAZyme Information: Z517_04490-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_04490-t43_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
757	KN846971|CGC8	81611.56	7.4364

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846971:1672538-1674811(+)

Full Sequence      

MSLVENLSDFSSLPSPLPPAPDGDLFTEQQLDTLFSILEVFVPSIPISATSKAGHPTELD
EALAKLKPYQPEGASEDVARAYLREDAVSHPDFREAVVRKFKLTVPASDSQGLAFLLSLL
NSSVGSYPLTGYTTPLHKQDLETRSRIICGWSRSRLPLLRGVYKSLSGLAKQVWVATSPG
LYRFLDFPSVPKHIERNPSFDFKFYDFTPPSTSTTLSTDVVIVGSGCGAGVVASHLSRAG
LKCLVLEKSYHFPSTHFPMSAANAGEHLMDNGGIYLSDDASIAILAGSTFGGGGTVNWSA
SLQPPRPVREDWAADNLPHFLGAEYQDCLDTVCERMGAARTTDPEALQKIEHNFANRTLL
EGSRRLGIAVQIVPQNTASKRHFCGYCMYGCSSATKQGPANCWFPDAAAHGAEFIEGCWV
EEVVFSGRDGIKTATGVKATWMSRDRKTSRQLTISARRVIVAAGTLQSPLVLLRSGLKNP
HIGAHLHLHPTSTVWATWPQRTNPWEGAILTVAMTGLEDQDGKHHGPKVEVICSTPGFGL
LTLPFRPKHALNAKPGESALSAAIEWRLSAAKHGFSTGFVCITRDADAGRVYPDPKDATR
RRPRIAYTPSARDRRHLLAGIVGGMQAAFVMGALEIDSGHPSVDRWVRPSHAQSTSIPTT
DDDEISFARFVDDVRCAWLADPGALAAGSAHQMGSCRMASSPKTGVVDSHGRVFGTEGLY
VADASVFPSASGVNPMVSTMGVAEWIARGIVREVKGA

Enzyme Prediction     

No EC number prediction in Z517_04490-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	212	752	3.5e-50	0.5097087378640777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	6.32e-60	271	491	7	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	3.71e-52	215	757	5	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.54e-29	589	744	5	141	GMC oxidoreductase. This domain found associated with pfam00732.
235000	PRK02106	2.35e-10	415	747	219	528	choline dehydrogenase; Validated
215420	PLN02785	2.23e-04	657	757	499	583	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	5.05e-158	17	754	16	734
ATJ01065.1|AA3_1|AA8	2.51e-12	212	744	231	760
ANA11091.1|AA3_1|AA8	1.30e-11	212	751	224	762
ATY58902.1|AA3_3	1.19e-09	219	754	11	606
BAC20641.1|AA3_1|AA8	1.39e-09	219	744	231	755

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KDG_A	4.53e-10	210	751	1	540	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
1NAA_A	7.81e-10	219	751	4	535	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
4UDP_A	7.74e-07	431	753	237	530	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
6F97_A	7.74e-07	431	753	237	530	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4UDR_A	1.77e-06	431	753	237	530	Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688],4UDR_B Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ8|FAO1_LOTJA	1.21e-78	219	755	238	745	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|B5WWZ9|FAO2_LOTJA	8.37e-76	216	755	237	747	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|Q9LW56|FAO3_ARATH	1.08e-75	216	754	231	740	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|Q94BP3|FAO4B_ARATH	6.18e-69	219	751	239	739	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|O65709|FAO4A_ARATH	5.57e-68	216	755	222	723	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Z517_04490-t43_1-p1.