CAZyme Information: Z517_04468-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_04468-t43_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401		44250.76	4.4551

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846971:1601234-1602496(-)

Full Sequence      

MSKYIDGPLSSPLNKRQFSYGSTPVRGVNIGGWLVLEPWITPSIFQQYGGNVVDEYTLCQ
QVPNAGDVLRNHWDSWASLSDFQKIAANGFNTVRIPIGYWAFQKYEGDPYIQGAADYLEK
AIGWARETGLKVWIDLHGAPLSQNGQDNSGQRTSTPGWTTGDSIDATLNVIRQISQQYAT
PAYADVISGIQLMNEPSLSKLPGGRDATQSYYESGFGVVRETGQTAVIIHDGFAAPSSWN
GVLTGQGSSGAIVDHHEYQVFSDDLVAMSPEQHVDYLYSHASTWAQGQDKFVICGEWTAA
MTDCAPALNGYGVGARYDGTYSQHNSNGGYSGSPYVGSCANINFIDQWSDYNRTTTTNYI
RAQLDVYETQIQGWFFWNFKTEAAAEWDLFRLIDAGVWPGF

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	71	382	1.3e-107	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.29e-54	25	399	18	382	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.23e-11	80	297	28	236	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFF92519.1|GH5_9	1.63e-155	10	399	18	403
QFF92520.1|GH5_9	2.16e-153	10	399	18	403
APA09967.1|GH5_9	8.43e-153	10	399	18	402
ATZ49756.1|GH5_9	2.49e-152	10	399	18	403
CCD33819.1|GH5_9	2.49e-152	10	399	18	403

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.30e-109	18	399	2	379	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	5.22e-109	18	399	2	379	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	6.33e-109	18	399	8	385	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	8.67e-109	18	399	7	384	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PC8_A	1.79e-108	18	399	8	385	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	9.76e-114	9	399	19	404	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|P29717|EXG1_CANAL	3.79e-108	18	399	46	423	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|B8N151|EXGA_ASPFN	3.06e-107	10	399	14	393	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
sp|Q7Z9L3|EXGA_ASPOR	3.06e-107	10	399	14	393	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
sp|Q875R9|EXG_LACK1	1.25e-106	9	399	32	425	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000078	0.000000

TMHMM  Annotations     

There is no transmembrane helices in Z517_04468-t43_1-p1.