CAZyme Information: Z517_03595-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_03595-t43_1-p1
• CAZy Family: CE4
• CAZyme Description: trehalose-phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
967		108716.43	6.8698

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846970:4497828-4500731(+)

Full Sequence      

MTIFVATLFLPYTINFDIPSCTSRPESPELPRQQISLTQNTPSDTQTVSLFTPGAVSGSP
LSQLSQSSGPIPPTPGATTDHEKIFRPHTERKISLTLPNVKKEAPVPVRAISRHDLHSPG
WGKTFTWNQPPSRAKSPPPSSILKHAVVSARDVKEVKERAISLAHNATHRGRRQRTRTVS
HERHFSHDSYTVEKAIIGNGGLYNAIDAAVDAGICEEKTWVGTLGCPVDALDEHLKENIA
EKLENDYDCLAVYTSDSDLNGHYEHYCKTILWPVVHYQIPDHPKSKAYEDHSWVFYAKVN
EAFADRIAKNWKKGDVIWIHDYHLLLLPNLLRQRLPEAQIGFFLHTAFPSSEIFRCLAVR
TNLLQGMLGANMIGFQNDEYGHHFLQTCSRLLNVEATKHGVILEDGRFVHVNTCPIGIDP
KAIDLQRQAKEVKEWVHTITDKYRGKRIIVARDKLDSIRGVRQKILAYELFLNKYPEYRD
KVVLIQIATSSAEDPELSATVADIVTRVNSTHSTLAHQPLVFLKQDIDFSQYMALLTVAE
CLMITSLREGMNLTSHEWILCQDGKISQNKYGPLILSEFTGSATVFGHNALLVNPWHYSH
CADAIKQALDMSPEERENRWKALYDIVVHQNAVGWFEHYVKGLEHAWKEHTVRDSTAVPR
LSLPSVKSKYLKAKKRLIILDYEGTLASWGSPTDIILTTPKRSVDVLNDLIEDKKNIVYV
MSSRMPEEMERLFSPVSGIGMIAENGAFVLDPGTDEWQELTNLEHVRNWKKGVRSILQYY
VDRIEGSRVEERHASLIFDYSDAEDRQGAFKQAGECANHINDACRGQNVNAIPIEDGLNI
SEMDVNKGAAAQLIGENLEKQGQGKDFPDFLMVIGDSREDEYVFNWAHRLEKAGKIRDVV
TVTLGARSTEASATLTQGVTGKLDLYSQPYTVTNILSRCIVNSGETRVVSAESVKFSAPI
RLDVVRG

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	172	644	2.2e-157	0.9747368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	198	644	26	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	3.25e-177	200	644	31	469	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	1.93e-150	200	884	28	687	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
223457	OtsA	1.09e-148	220	649	64	484	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215555	PLN03063	7.05e-127	170	884	7	719	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46441.1|GT20	0.0	1	923	1	913
BCS07788.1|GT20	0.0	1	923	1	913
BCR95224.1|GT20	0.0	1	923	1	913
QMW41842.1|GT20	0.0	1	923	1	915
QRD86165.1|GT20	0.0	1	923	1	915

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	4.75e-96	239	643	61	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5DXF_A	3.61e-93	261	640	146	520	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5HUT_A	2.84e-91	197	654	29	478	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	2.84e-91	197	654	29	478	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HVM_A	8.27e-88	197	643	37	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14081|TPSX_SCHPO	2.24e-196	87	930	98	942	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|Q9UUI7|TPSY_SCHPO	1.84e-182	4	913	5	874	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|P38427|TSL1_YEAST	9.68e-158	185	850	341	983	Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSL1 PE=1 SV=1
sp|P38426|TPS3_YEAST	1.78e-157	185	854	309	952	Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS3 PE=1 SV=3
sp|Q54NU9|TPSB_DICDI	7.07e-120	216	900	94	774	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.856664	0.143349

TMHMM  Annotations     

There is no transmembrane helices in Z517_03595-t43_1-p1.