CAZyme Information: Z517_03309-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_03309-t43_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674		73059.06	4.7816

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846970:3708773-3710911(-)

Full Sequence      

MRATLALITLLGGTTVSALRDDNNITQTIRVDNSTTDPTAYDYVVVGSGPGGGPLASRLA
IAGYRVLLIEAGDDQGEATWQQVPALQLQATEFTPMRWDYFVNHYQDLARQEQDSKMVWK
TPSGDEYVGNSPPSGSTPLGIWYPRTGTLGGCSAHNAMITIYPHESDWNNIASITGDSSW
SAGNMRKYFERLERCRYLPNSVVGHGFDGWYETSLTELSLAVEDQKLLSLIIAAGTAMGK
GLLGMVLNTVAGLGEVLLRDINADVPGRDSQEGLYQVPIAVTEVDKKRNGPRDFILDTAN
AVNADGSRKYHLDVKLNTLVTKVRFDTSGSKPKAVGVDYLEGQSLYRADPRAGSAAGGTP
GSVNASREVIISGGAFNSPQLLKLSGIGPAAELSKFGIPVVVDLPGVGTNLQDRYEATLV
GDSNTDFAITKDCTFLRTEPDPCLEQWQTQPGPFLKGTYATNGIAIAVIKKSSVADGDPD
LLISGAPAFFTGYHPGYSNESLKDAHHWAWIVLKAHSRNNAGTITLRSTDPRDTPVINFN
YFDTGITTDDADEKDLQATYEGMELSRKMFQDYIPLQGTFKEVWPGNKATTEAQMKDWIK
KEAWGHHASCTCPIGADDDKMAVLDSQFRVRGVDGLRVVDASVFPKIPGFYIVLPTYMIS
EKAADVILEDAAST

Enzyme Prediction     

No EC number prediction in Z517_03309-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	40	670	1.8e-100	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.43e-68	55	668	20	532	choline dehydrogenase; Validated
225186	BetA	8.33e-66	55	672	22	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.07e-31	522	663	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	9.60e-23	312	649	235	558	Protein HOTHEAD
366272	GMC_oxred_N	2.78e-13	144	416	22	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW39616.1|AA3	0.0	26	672	31	678
QMW27545.1|AA3	0.0	26	672	31	678
UDD55433.1|AA3	0.0	26	672	31	678
QRD81945.1|AA3	0.0	34	672	23	659
UPL01126.1|AA3	0.0	36	674	42	676

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	2.05e-38	41	667	41	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3NNE_A	3.78e-35	29	667	1	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	3.78e-35	29	667	1	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	9.28e-35	29	667	1	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
5NCC_A	2.13e-33	30	664	10	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6UPE0|CHDH_RAT	2.76e-48	41	667	46	576	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	5.99e-48	39	668	3	531	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q8BJ64|CHDH_MOUSE	3.24e-47	41	667	43	573	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q47944|SDH_GLUOY	4.04e-47	39	671	3	531	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q4K4K7|BETA_PSEF5	6.57e-46	41	665	5	531	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000773	0.999191	CS pos: 18-19. Pr: 0.9745

TMHMM  Annotations     

There is no transmembrane helices in Z517_03309-t43_1-p1.