CAZyme Information: Z517_02354-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_02354-t43_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1007		107607.28	4.2989

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846970:1071484-1074778(-)

Full Sequence      

MSNRCSAYLLTILQVLFASALPFRQLFGRSSDLDPACSRGDEDVYGGGLLTFASVYPGAD
ATLTTGDSLDSDNAPVAHEADVESQSYSSAITFADPHLSIQTITITALPSSQVPTVTSAS
QSFPDTTGSLITTLETEGNPPVQPFPTSVQTVASPTLEPLNNTGPFGSSTAISAQSTVTE
TITLPLTTFESLSTTQTVATVAVETTAVITAVTVLNTTITVDGSIVATSSAGTTVFTTTG
TDLVETTLTASSTVTGTVATTLTTALGSISNLPTVSPNCLLGMGCSGQDIFQPVALGQPP
NNIEQRGGHPVPRLGIVDAGGPIETNKFYQNFVLGSQGSPCFVMPYSLAWSKGSGNALSW
GMAISHLDDSQKHFGPNNTAIPNAPASYYINGLGIQSVILSAVEFGSNTVLTTDSLLAFS
ANVRLQPSSGSPSVLTMPVVQGMAFVTGQYINLQPAIQSSVFFRNVAAAGEPKPGIFKYR
VTLEDGKLWLIYAIPANGLTPNFQLVSSTVLRGLPNWYGDIQVAKLSDDSLESIYDDAVG
AYPTAGHVSGFAENTTAQYSLSWSKGGVYSSNTTLLMFALPHHRDSFDFSTQCNVTAIEL
ATTTKGNATAVVGDYWVLEEQNLPISLGFAPWRPGNSPNFHGASTLSPAALSIIQTVSAT
EASQNMSVQTNLNSMYYSGKALSKFAQLVYTMHDLANQQDLANAALLELESCFDVFTNNQ
QQFPLLYDTDWKGLVSSASYVTGDPGVDFGNSYYNDHHFHYGYFLHAAAVIGYLDPTWLN
QNKDYVNALVRDVSNPSVLDQYFPVFRSFDWYHGHSWAKGLFESGDGKDEESSSEDAMFA
YGLKMWGKTVGDASMEARGNLMLAVLARSLQNYFLMTSDNTNQPAAFIGNKVTGILFENK
ADHVTYFGTDLSYVQGIHMIPLMPFSTLTRTEQFVTEEWITYFADGAVRQATDITGGWKG
IVYANLAIINPTAAYNFFTQPSFDMGWIDGGASLTWYIALSALLGGA

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	317	999	1.8e-219	0.9758842443729904

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	0.0	645	998	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	0.0	309	1006	75	757	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.37e-139	309	634	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD56325.1|GH81	1.33e-302	286	1007	6	724
QRD82801.1|GH81	7.98e-301	268	1007	176	910
QMW28320.1|GH81	7.98e-301	268	1007	176	910
QMW40391.1|GH81	7.98e-301	268	1007	176	910
BAE58039.1|GH81	2.69e-300	286	1002	6	719

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBZ_A	7.23e-103	265	1002	8	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K3A_A	1.08e-102	287	1002	5	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
4K35_A	1.49e-99	287	986	5	705	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.60e-28	603	980	255	636	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	5.51e-16	676	991	361	671	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	3.12e-273	263	1002	171	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	7.03e-185	289	1007	2	705	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	3.41e-162	289	1001	401	1109	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.15e-156	309	1002	66	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	8.25e-151	289	1002	427	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000346	0.999650	CS pos: 20-21. Pr: 0.8980

TMHMM  Annotations     

There is no transmembrane helices in Z517_02354-t43_1-p1.