CAZyme Information: Z517_01985-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_01985-t43_1-p1
• CAZy Family: AA4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627	KN846970|CGC8	69543.66	7.3891

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846970:58771-60818(-)

Full Sequence      

MGLFTELPEEFKEVDVIIVGGGTAGCVLSSRLAEADPSLSILVIELGMNNYNVPQVVQPA
LFPLNLDPGSKYTLFWKGNRAPQLADREPIVPSGNTLGGGSSINWMVYTRAQRSDLESWK
TPGWSSKELLPFLKKFETYHGRGEKELHGDSGPINISSGTFRATRAENEFIDAAAKMGYR
ELKDLQNLDSNNGTERWLRYVGPDGRRQDAAHRFLHPKLQSGHYPNLHVLTENQVVRILL
DDNKRAVGVEYRPNPKFQASARGKALLTARASKLVIVSAGANATPLILERSGIGDSKILK
RAGVPVVEDLPGVGNDYQDHHLTLYTYRTSLRPTETINAFADGRLNVQEEIRKNNKQLGW
NSMDASGKFRPTEAEVEALGPDFKRAWDRDFKNSPDRPLMIIAMYLSFFGDHSTLPDNSE
YVSMANWTAYPYSRGHIHITGPNVSDPIDFDVGYLKDPNDIDVKKHIWAYKIQREIFRRM
NIFRGELAADHPKFPPGSKAAVVEKADGPVADDAKRIQYTPEDDKAIEENIRKIVTTTWH
SLGTCKMAPREQKGVVDASLSVYGTEGLKLADLSIVPENVGANTNNTALLVGEKAADIII
RELGLGGKIRGRDAGGYSRENLNIARL

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	12	604	5.7e-277	0.9983050847457627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.62e-85	12	599	4	531	choline dehydrogenase; Validated
225186	BetA	1.43e-81	12	602	6	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	1.62e-37	87	320	17	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.26e-32	431	595	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.99e-17	15	602	57	579	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS68623.1|AA3_3	2.30e-311	1	608	1	606
UJO12159.1|AA3_3	1.54e-299	1	609	1	595
SMR45817.1|AA3_3	8.36e-298	7	605	7	608
SMY20971.1|AA3_3	1.68e-297	7	605	7	608
UJO18841.1|AA3_3	2.88e-297	21	605	7	596

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6H3G_A	2.54e-152	12	605	5	626	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	1.01e-151	12	605	5	626	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5HSA_A	8.66e-138	7	608	3	641	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6YS2_AAA	1.55e-50	8	606	2	567	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	7.63e-50	8	606	2	567	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00922|ALOX_CANBO	6.63e-146	7	607	3	640	Alcohol oxidase OS=Candida boidinii OX=5477 GN=AOD1 PE=1 SV=1
sp|P04841|ALOX_PICAN	2.07e-138	7	607	3	641	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|C4R702|ALOX2_KOMPG	3.16e-137	7	608	3	641	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1
sp|F2R038|ALOX2_KOMPC	3.16e-137	7	608	3	641	Alcohol oxidase 2 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX2 PE=2 SV=1
sp|P04842|ALOX1_KOMPG	4.46e-137	7	608	3	641	Alcohol oxidase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000029

TMHMM  Annotations     

There is no transmembrane helices in Z517_01985-t43_1-p1.