CAZyme Information: Z517_01926-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_01926-t43_1-p1
• CAZy Family: AA4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
696	KN846969|CGC17	80945.08	5.4281

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846969:5259323-5261413(-)

Full Sequence      

MGPIEFNKRRIILLIASIIAFYIVFHGLSPSGDNFREVASHIPIPGHLNPTEHKLPPPAP
DPDTIWDLGPDPSPPPEPEHEPEHETDSEKPTPPQSQPVEHFDLHPIAQLMREADTEWRT
YETDISTTFRQTVEKYRSKYGRHPPPGFKDWYKFARKRNVFNIDDFNQIMDDLRPFWAIN
ASVIRSHAAHMWENPDFGVSVLHIRNHKVVRVDNPSWRSETMEKVIEKCIKFLPDMDIPM
NRLDQPRLIVPWEDMQEFLRKEYHTRVMAPEVTDSFTKDLPELLDMSIEDKELDHSTRLS
EDWIFAPGKQYMNLAAKGCPPESPARAKMSVAEADALYKEPKLGFVKNFNLSTDLCTVGP
TIQDLHGMLYSASSVIASHKLVPIFGECKVSVNNDILFPANMYYQHDVRYDYNGEEDVDW
RDKQDNTIWRGVTSGGVQLEDNWDRMHRQRLVQLFNGTYMQMTGKEVKTLTEKDDGPGKV
NTTYELYDRFKPSEFADRHSDIGFTEPMSCLPNCSFYNSVFSWKPQVPLTSQFKSRYLID
VDGHSFSGRWHAFLQSKSLGLKATIFREWHDSRLLAWRHFVPVDNRYDDIYGLLTYFIGY
GKPYKQHAEEGEDLNPRVFIARHDREAQTLARQGREWANKVLRREDIEVYMFRLLLEYGR
LIDDNRDFIGYSGDGSELDKFDEGEEDEGRWGIGGW

Enzyme Prediction     

No EC number prediction in Z517_01926-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	376	662	2.5e-73	0.916

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	3.20e-19	379	661	28	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.11e-09	526	661	207	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ52302.1|GT90	5.23e-252	7	682	6	641
CCD43842.1|GT90	7.42e-252	4	682	3	641
APA10807.1|GT90	5.81e-249	103	683	72	643
VDB94907.1|GT90	3.79e-226	111	682	1	555
QSZ37292.1|GT90	7.94e-218	103	649	72	610

PDB Hits     

Z517_01926-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.43e-44	105	667	152	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999753	0.000277

TMHMM  Annotations     

Start	End
12	29