CAZyme Information: Z517_01211-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_01211-t43_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405	KN846969|CGC16	46177.74	7.0732

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846969:3354177-3355686(+)

Full Sequence      

MLLPKGGVTWKSAKARLPPWKAIIMFLTRTRFLVAVALTGLIVLLWRGISVSTQQMSNFY
CFGPSKPPTQMSNNELVAWNQHLQTPVLFNHHEPYEVNASTINRIDLNPIVSTPRALSNR
ERILILTPLRDAAPYLIKYFDLLSELTYPHDLIDLAFLVGDSVDDTLAVLSSELNRIQQR
TDKIPFHSVLIVEKDFGSKLDMSVESRHGFAAQGPRRKAMGRARNYLLSAALKPEHSWVY
WRDVDIVDSPKKIIEDFVAHDRDILVPNIWFHRYENGRDIEGRFDYNSWIESDKGRRLAA
SLDKDIVLAEGYKEYDTGRTYMARMGDWRNNKDEEIELDGIGGVNILVKADVHRSGINFP
CYAFENQAETEGFAKMAKRAGYQVVGLPNYVVWHIDTEEKPGNAA

Enzyme Prediction     

No EC number prediction in Z517_01211-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	100	362	1.3e-107	0.9850746268656716

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	1.62e-159	101	363	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD70999.1|GT62	2.59e-247	1	404	1	404
UQC85603.1|GT62	3.01e-246	1	404	1	404
QKX56390.1|GT62	1.76e-242	1	403	1	404
CDP26346.1|GT62	7.30e-242	1	403	1	401
CAP73945.1|GT62	7.30e-242	1	403	1	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.62e-64	102	398	6	303	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	3.95e-95	88	395	48	355	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	9.20e-94	100	395	75	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	5.62e-80	100	395	170	512	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	8.70e-75	100	395	74	419	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	1.23e-67	102	394	73	365	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000011	0.000005

TMHMM  Annotations     

Start	End
32	49