CAZyme Information: Z517_00922-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_00922-t43_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526		57434.53	6.5810

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846969:2531308-2533033(+)

Full Sequence      

MLAPCIVAVLLMVKVTTCTISLSVAPPQNASKPLLESFVSYSIEFSSFPDFAGNISHPNN
FSYNLLKNLRDLQGTYPIVRVGGNTEDYATFNASQKAALIGTFNFTRSRDYPTTISIGPN
YFDSYSTWPGVTYIHGFNMGKNGSIGYETLIGTAPLVCKALGTTKTAYWEVGNEPDLYKT
SAQGPVRPSWWNETDYVQEWLNKTRTIRQLVQQNCPEIISQGKFKFYAPNFAGTSNSLNL
ITTWQAGLDADNNIAFIDSHNYIGGATQPGVTLQGTLMNHTSTVLSVSKHLNESSLLAYT
GLPYILGETNSLYNEGAPGLSNSFGAALWGVDFNLYCAATGIARVHMHQGTNYRYASWQP
IPTVNESLGTKAPYYGNIMVATFLGDLTKNSVSISDIELGNIHQNAYAAYVNGRLERIAI
VQMNAYNYTSSGTQEPRPSETFSFQLPTTNTVSTARGASVQRLMANGSDAITGITFDGWS
YNHELQQGKPVKLNNVTSGEVLQIAQGGILTVTVPWSSAVILNLQW

Enzyme Prediction     

EC	3.2.1.31:3	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	36	500	2e-82	0.9516483516483516

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	4.59e-26	406	521	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX60609.1|GH79	1.20e-208	27	525	32	527
CAK96418.1|GH79|3.2.1.-|3.2.1.31	8.85e-204	19	524	34	541
BCR93948.1|GH79	3.57e-203	16	524	31	541
BCS06559.1|GH79	3.57e-203	16	524	31	541
APA08818.1|GH79	1.79e-195	27	523	29	536

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	6.75e-39	19	525	4	460	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]
5G0M_A	7.83e-23	28	381	14	358	beta-glucuronidase with an activity-based probe (N-acyl cyclophellitol aziridine) bound [Acidobacterium capsulatum],5G0Q_A beta-glucuronidase with an activity-based probe (N-alkyl cyclophellitol aziridine) bound [Acidobacterium capsulatum]
3VNY_A	8.55e-23	28	381	14	358	Crystal structure of beta-glucuronidase from Acidobacterium capsulatum [Acidobacterium capsulatum ATCC 51196],3VNZ_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum in complex with D-glucuronic acid [Acidobacterium capsulatum ATCC 51196],3VO0_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum covalent-bonded with 2-deoxy-2-fluoro-D-glucuronic acid [Acidobacterium capsulatum ATCC 51196]
5L77_A	2.15e-22	28	381	34	378	A glycoside hydrolase mutant with an unreacted activity based probe bound [Acidobacterium capsulatum]
5BWI_A	4.93e-11	50	376	29	323	Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei],5BWI_B Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QEQ6|GUS79_ASPNC	1.57e-204	19	524	34	541	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1
sp|Q7SFB0|GUS79_NEUCR	2.30e-178	31	497	30	522	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000700	0.999278	CS pos: 18-19. Pr: 0.8849

TMHMM  Annotations     

There is no transmembrane helices in Z517_00922-t43_1-p1.