CAZyme Information: Z517_00594-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_00594-t43_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629		68245.07	5.9170

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846969:1643541-1645532(-)

Full Sequence      

MATTNGADGTQKSALVAADEFVGREYDYLICGGGTAGLVVAARLTENPDVTVGVIEAGKS
RLGDPLVDVPAMFIQMLGNKEYDWAWETIPQPGNKNKVHQVPRGKALGGSSAINYMMYVR
GSDQDYDDWAELANDPSWSSAQMKQYMRKHQTLEPVDERITDRSTMPFVGENHGTSGPVR
TSFNDFRLPIEDDVIKAADHVTGFDKKPLDPWSGDHIGFFNTLGAVARTGPNKGMRSYAA
RGYFQPNEHRPNLKVVTEALVARVILENKRATGVEFVHSGQRHTVKAKREVIVCGGTINS
PQILEMSGIGNPDILRAAGVQCLVDLPSVGENYQDHVATAAVYQLADGQMSGDSIYKPEV
MEAAQKALAEEKGGPLTAIQSTQGFFPCALFLEDGELEEVVKSIESAKAKATPFQRKQWD
QVISHLKNNKSANLQLVFIAVTGNLAEGPRDQSTLFPPPPEGAKDGVTLAVCLQYPVARG
YIHIKSADPAVAPEINPNYLGHEADVAVLAAGLKFVDKTASSAPLKDKISHRIAPEPDRF
PLDSAQSRRSAIREYVLGEYHSCGSCAMGDTVDSRLRVKGVQNLRVADASVFPNNVSGNI
ASSVYMLAEKAADMIKEDWDYAALNKLSK

Enzyme Prediction     

No EC number prediction in Z517_00594-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	25	618	5.4e-173	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.94e-120	24	616	4	532	choline dehydrogenase; Validated
225186	BetA	5.24e-118	22	618	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.48e-38	476	611	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.34e-37	101	338	21	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.11e-15	26	607	56	568	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO22487.1|AA3_2	7.55e-263	1	624	1	625
SMQ52591.1|AA3_2	4.89e-260	2	619	12	630
SMR55413.1|AA3_2	4.89e-260	2	619	12	630
SMR57790.1|AA3_2	4.89e-260	2	619	12	630
SMY26225.1|AA3_2	4.89e-260	2	619	12	630

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	3.65e-69	25	618	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.96e-68	25	618	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	8.27e-67	26	618	6	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.82e-61	26	626	6	593	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6H3G_A	2.44e-59	25	618	6	623	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	2.08e-163	19	618	7	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	1.13e-154	14	618	2	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.13e-154	14	618	2	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	2.02e-91	13	618	27	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	2.04e-89	23	615	44	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999978	0.000090

TMHMM  Annotations     

There is no transmembrane helices in Z517_00594-t43_1-p1.