CAZyme Information: Z517_00543-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_00543-t43_1-p1
• CAZy Family: AA2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
593		64007.20	6.8073

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846969:1505837-1507797(+)

Full Sequence      

MNHLKPRGPLTAFLFFLVYLHQTLADPAIYCKPVPSSQNWPAQSAWQKLNETISGRLFVD
VPPGAVCHPGNSLFNNVTCAFVLSQWTNSSFHANNPISADYNDDGCLPSPLAPCSVAAYP
SYVVHATKASDVQAAVEFAANTGVRLIVKGTGHDLLSRSSGGQSLSIWTHNIVGVSVNTS
DPRALPYGGVGSVKIAAGSRMAEVYQEVAKHNLTVIAGGDMSVGIGGWILGGGHSPISST
YGLGADQILEMEVVTPDGEFVTINEKSYPDLFWAMRGGGGSTFGVLISVTMKVYPTLPGS
LAIFFINTTSNSDTFWSISTYFTSQVPSLSDKGANGYHYFVPYAPPNPPDQAGVIVGGYF
FPNKTATQVNAILGPVITKINTTDWGDEVFVATETIPIPDFTKFWMTNQPETVGPSERLG
SRLLSRGALTGNQTALENALRTASNGTWTLLNHLVAGKGVRDAKIPGGNNSVCPAWRNNT
YIHFVTYRQWTPLNQTEKTAVTDELRNRAIEALRILDPHTGAYVNEADPTEPNWQTTFWG
SNYPRLLALKKKYDPKGIFWCKPCVGNELWNVTGSSATQDGIGQDGGMICRSQ

Enzyme Prediction     

EC	1.1.3.-:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	116	559	8.1e-58	0.962882096069869

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	7.59e-16	120	264	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	8.45e-16	118	559	30	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
369658	BBE	1.64e-14	522	560	1	39	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	6.79e-07	120	285	65	230	cytokinin dehydrogenase
273751	FAD_lactone_ox	1.69e-05	192	322	78	210	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	5.75e-67	24	571	493	1055
QKD57322.1|CBM91|GH43_11	5.75e-67	24	571	493	1055
QRW27390.1|AA7	3.74e-20	120	566	66	491
UQC87672.1|AA7	3.83e-20	93	567	26	497
QRC92907.1|AA7	1.19e-19	107	567	57	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	1.78e-73	31	572	28	565	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	1.30e-65	31	568	30	585	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6FYD_A	1.42e-21	120	559	45	453	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYE_A	3.39e-21	120	559	45	453	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]
6FYB_A	3.39e-21	120	559	45	453	The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_B The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_C The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_D The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYC_A The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus],6FYC_B The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AS41|A7056_ARTBC	3.33e-96	4	574	1	584	Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07056 PE=1 SV=2
sp|A0A0E0RTV6|ZEB1_GIBZE	8.49e-89	20	572	16	554	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|A1CFM2|PATO_ASPCL	3.27e-80	23	572	21	559	FAD-linked oxidoreductase patO OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patO PE=1 SV=1
sp|A0A1V6PBT1|CALF_PENDC	1.56e-76	31	575	27	569	Bifunctional decalin synthase calF OS=Penicillium decumbens OX=69771 GN=calF PE=1 SV=1
sp|G0R6T3|SORD_HYPJQ	2.22e-75	31	573	39	565	FAD-linked oxidoreductase sor8 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=sor8 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000195	0.999765	CS pos: 25-26. Pr: 0.9785

TMHMM  Annotations     

There is no transmembrane helices in Z517_00543-t43_1-p1.