CAZyme Information: Z517_00455-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_00455-t43_1-p1
• CAZy Family: AA2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549	KN846969|CGC14	58579.48	5.9655

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846969:1295133-1296782(+)

Full Sequence      

MAAAEGIFDYIVVGGGIAGCALASLLSKSKSSPSILLIEAGPDVSGHPLTQSPLGCFAAH
GSDIDWNYKTVPQPHLNDRSLYEAGGKALGGGSATNYATWTRGPKVDYDRWGKLVGDARW
TYNGLLPYFDKIEKDHISTVAISKSHPDRKSPLRDQVLKAWLDLRLSQIENANVGEPLGV
GEVVENLKEGKRQLASAAFDLRDVKVMTETAAQKVLLENRQGKLTAVGVQIHGERHFLAS
KEVILSAGAFRTPQLLMLSGIGPAADLEEANIPTQLDLPGVGLNFHDHLLVGFAFRLKNP
SLGLAMGGVAGPWAEPAHQLGLPVDWVVTENVPRSFLEEAVKKDMVGDSSGDGDTYPVSL
LDSESVHLESIMMYAPGGLPITNLHVPFDGTHIGAVVGVMSPTSRGRIGLSSSSALDPPV
IDPNYNATNVDRALMRYGIRRLLQAVQHSMSDVVESENPPPSFEALSYTSSDSAIDARVR
SEARTFFHAAGTASMGPVVDTQLRVKGIDGLRVVDASVIPIPIGAHLQAATYAIAAQAAD
MITQENGRR

Enzyme Prediction     

No EC number prediction in Z517_00455-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	544	9.7e-137	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.94e-86	8	524	6	514	choline dehydrogenase; Validated
225186	BetA	2.42e-72	1	528	1	519	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	3.84e-34	77	289	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.85e-33	402	528	1	133	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.22e-26	8	518	56	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ69664.1|AA3_2	5.35e-177	9	542	10	551
UKZ94523.1|AA3_2	4.94e-175	9	542	10	551
BCS24407.1|AA3_2	2.35e-169	9	543	5	560
EAA58856.1|AA3_2	2.13e-168	8	542	6	553
BCS16263.1|AA3_2	3.22e-167	8	542	5	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FIM_B	1.94e-58	8	542	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	7.08e-58	8	542	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3Q9T_A	2.37e-57	8	546	7	573	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	3.28e-57	8	546	7	573	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	4.56e-57	8	546	7	573	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	5.94e-114	8	542	5	518	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q9WWW2|ALKJ_PSEPU	1.91e-63	8	545	2	530	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q988C9|4PADH_RHILO	5.96e-63	8	549	7	540	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	2.23e-58	8	535	51	617	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	6.14e-58	5	542	33	607	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999599	0.000421

TMHMM  Annotations     

There is no transmembrane helices in Z517_00455-t43_1-p1.