CAZyme Information: Z517_00174-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_00174-t43_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
729		80132.16	4.6042

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846969:537178-539420(+)

Full Sequence      

MWPLLSLGCGLLGLVLADVSVSISGTDPFSLHVTSDQGITVVNKAILGGDTNNTAEAVSA
SNDGVVANSGGLIDWSLVQPNVVRIQYNSSVAFTGAQFTAGPHESFYGVWEYPWNNSLTN
NGVEFDLKGVGNALGVNWDNARAPAFYSSAGYGVYADTLDMGSFQFTPAQAQFIFNTSSL
TYYIILATTPGDFKSIIETYTGLSARITMPPDAGYGPTFWSDNFETDFHGSVSNAQQNYY
DVIDHLYANQIHATSMFADRPYGTGNYSWGNFDFDPVYYPTPREFIANLSNWGFDFQVWA
ANRAFLDTELYNASVAGGWLFPGINPEFFLGPALNLSIPAAYEYVLNKMAYFPSVGVKGF
KIDRGEEGEMPVWEQNIQMRLFEQICETVMANKWGKSGFYSFARSVVDRSRSLTNVWNGD
SHANFTGLRYSIASGIRASLLGFSTWSSDTGGYVRSPNLVADQPTPELWARWMHFSSYSP
VYEIMVGTNHTPWYAPYPTRLVSVLKATANEHHALIPYIKSFTYQATQTGISVMRALFLE
TPDDTLVYDTTDAYFFGDSLFVAPIVQEGGTRDVYFPKSSVGNRTARAYLEYYNKTAVHQ
GGSSATVNLEWESNPVYVREGSIVVRGDTYQGNNKWTQKWQPSLTIEVFPSYTYPTSSFP
YYNGMEVVNITLSSQSTSGTVVVQWDGALGIPSPPQVVFYGKSGAQNASVKTTGAGGSAQ
ITGFQSVFG

Enzyme Prediction     

EC	3.2.1.177:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	182	624	1e-66	0.9976580796252927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224418	YicI	1.35e-60	92	684	141	725	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	1.08e-56	183	624	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	1.32e-32	270	578	48	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
269889	GH31_GANC_GANAB_alpha	6.00e-31	416	630	231	432	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
236731	PRK10658	2.29e-29	146	621	198	665	putative alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UJO21215.1|GH31	5.34e-262	26	728	38	725
AEY65035.1|GH31	1.48e-44	81	687	134	727
AJQ29838.1|GH31	1.65e-43	144	627	198	672
BCS28368.1|GH31	1.94e-43	78	626	155	695
ACL76784.1|GH31	2.16e-43	81	687	134	727

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F7U_A	2.98e-33	55	683	210	865	Cycloalternan-forming enzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]
2F2H_A	1.65e-30	69	631	125	676	Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	1.67e-30	69	631	125	676	Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
5I0D_A	4.44e-30	55	683	210	865	Cycloalternan-forming enzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e],5I0D_B Cycloalternan-forming enzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e]
4KMQ_A	4.52e-30	55	683	231	886	1.9 Angstrom resolution crystal structure of uncharacterized protein lmo2446 from Listeria monocytogenes EGD-e [Listeria monocytogenes EGD-e],4KWU_A 1.9 Angstrom resolution crystal structure of uncharacterized protein lmo2446 from Listeria monocytogenes EGD-e in complex with alpha-D-glucose, beta-D-glucose, magnesium and calcium [Listeria monocytogenes EGD-e],5HPO_A Cycloalternan-forming enzyme from Listeria monocytogenes in complex with maltopentaose [Listeria monocytogenes EGD-e],5HXM_A Cycloalternan-forming enzyme from Listeria monocytogenes in complex with panose [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P96793|XYLQ_LACPE	6.87e-34	69	628	123	678	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
sp|Q5AW25|AGDD_EMENI	2.98e-32	93	623	167	695	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
sp|P31434|XYLS_ECOLI	8.47e-30	69	631	125	676	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
sp|Q14697|GANAB_HUMAN	4.51e-21	134	626	311	812	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3
sp|Q9BE70|GANC_MACFA	2.58e-20	387	646	409	656	Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis OX=9541 GN=GANC PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999714	CS pos: 17-18. Pr: 0.9685

TMHMM  Annotations     

There is no transmembrane helices in Z517_00174-t43_1-p1.