CAZyme Information: Z517_00107-t43_1-p1

Basic Information

• Species: Fonsecaea pedrosoi
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Fonsecaea; Fonsecaea pedrosoi
• CAZyme ID: Z517_00107-t43_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	KN846969|CGC22	43508.76	6.3180

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FpedrosoiCBS271-37	12573	1442368	46	12527

• Gene Location: location=KN846969:338066-339202(+)

Full Sequence      

MPSPLAIEALTATDISQKIELLIHNLVNIKDETGHFLLKLPDGRIIDTKGWHDWEWTHGI
GLYGLYQYHALTSSPVALSTMQDWFSRRLAEGTTKNINTMAAFLSLAYLYEETRERSYLP
WLESWAEWAMHDLPRTTFGGMQHITYLEENHNQLWDDTLMMTVMPLAKIGRLLNRPSYVE
EAKRQFLLHIQYLYDPQTGLFFHGWQFTDDGDAQLGHNFARARWARGNSWVTIAIPDFIE
LLDLPSDDGLRLYLVGVLQAQCRALRALQTKEGMWRTLLDVSEEEGSYQEASATAGFAYG
LLKSIRRRYISKEYLDVATRAIKAVIQRISKDGELSHVSFGTGMGKDLKHYLDIERTSMP
YGQAMAMMALVEFLRLYR

Enzyme Prediction     

No EC number prediction in Z517_00107-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	375	1.4e-106	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	7.14e-108	24	377	6	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	1.16e-99	28	377	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX50406.1|GH105	4.25e-201	4	377	5	380
QDS76750.1|GH105	7.20e-197	7	377	8	378
UJO23795.1|GH105	1.02e-196	5	378	6	379
SMQ55448.1|GH105	3.07e-191	4	375	5	376
SMR60657.1|GH105	3.07e-191	4	375	5	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	9.72e-178	11	375	4	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	2.96e-157	14	377	25	380	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.21e-152	13	377	25	381	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	8.10e-41	54	375	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	1.93e-12	155	374	201	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.36e-10	170	327	10	168	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.36e-10	170	327	10	168	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000001

TMHMM  Annotations     

There is no transmembrane helices in Z517_00107-t43_1-p1.