CAZyme Information: YNR067C-t26_1-p1

Basic Information

• Species: Saccharomyces cerevisiae
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Saccharomyces; Saccharomyces cerevisiae
• CAZyme ID: YNR067C-t26_1-p1
• CAZy Family: GT39
• CAZyme Description: endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1117	BK006947|CGC3	121064.45	4.1329

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ScerevisiaeS288C	6350	559292	443	5907

• Gene Location: location=BK006947:755746-759099(-)

Full Sequence      

MQLYLTLLFLLSFVECSYISFISNNADEILETDLIETLSYATLTVGEPYVAQSVVVTRVS
AASHSPLSVSPKNRVSASPINSQDSDSNTRTAVQLSLSLSNYASQVSQKISAQTNNDPVT
VSNIYANDNSKSKSSVHNLSSVSGVASVMPSASTMRKVTTLLSQTASTSTSTLFSSSLSI
SGTQLNGTLLTSVSKGTIDPLVTQMPSYSSQETKIIPSSLTSNKTIYTISVRTNAATATG
EDSFIASTPASSTLFYPSNSTQDLVQTLASTTASPAYPSNRTQITLSPSVSLYSTTSPIY
PSNITENGSSPSPSLSSTVSPVYPSSSTGNILLSSLFSTVDSSSSPVSSTLDTIYVSSSM
QATISSSSSSRQTKTSSSSLSTSTSSTATTTENSSTTTIVNLFNAVSTDEPPTVFDRSPN
PMSLADGVSNDGPIQTNKFYTNLIVGSQESPAFVYPYSLWKYTSSSYGFAVQHTTVDQYS
YGGYDSSGNAEYLVNPLGIAHVVFSASNFDSSMTMQVDEMTLSSTRVVLSESNDSSNYLE
IPLVQGMGFATGIYHGSLNAKIGSSVGFNTIVSESSSNLAQGILKYRITLLNGVTWLCYV
IGPDDLTSTDFSLEVSSEYEIKASASVDGLIIQLAVAPSETDYEVFYDQAAGMYVTNFKL
QGVSDGSTATYEFSYTTQGESASGSTMIFALPHHESSFSDIMQDYYTGIQLASTTKGVMN
GYLTTSLQFSTSLNRQISWLPWSSQLGSNLLEYSKEQLQLLAEVANSELQVSISESISGL
NTYYLGKVIDKYSYILLTVSEIIQDEASTKSTLENIKSAFDILLQNEQTYPLIYDTKFNG
LVSSGDWGSTSTQYDFGNTYYNDHHFHYGYIIHAAAVIGYVDSKLNGTWAADNKDWVNSL
VRDVANPSEKDEYFAQSRMFDWFNGHSWAAGLYENGNGKNEESSSEDYNFAYAMKLWGAT
IGDQSMELRGDLMISIMKDAMNDYFYYQNDNTVEPEEIIGNKVSGILFDNIIDYTTYFGT
NTEYIHGIHMLPITPVSSNIRSETFVEEEWQTKIEPIIESIESGWTGILKLNQALFDPVD
SYAFFSDSTFDSSTYLDNGMSRTWALAFSGGLANSIA

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	420	1108	8.5e-220	0.9903536977491961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	406	1117	61	760	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	753	1106	2	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	1.51e-113	420	744	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJT05179.1|GH81	0.0	1	1117	1	1117
AJT13839.1|GH81	0.0	1	1117	1	1117
AJT04431.1|GH81	0.0	1	1117	1	1117
AJT12309.1|GH81	0.0	1	1117	1	1117
AJT16827.1|GH81	0.0	1	1117	1	1117

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	3.36e-82	401	1106	7	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	5.47e-82	401	1106	32	737	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	8.78e-79	401	1106	7	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	5.55e-27	634	1088	203	637	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.43e-20	647	1081	252	654	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53753|ENG1_YEAST	0.0	1	1117	1	1117	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	7.48e-254	401	1115	427	1144	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.96e-171	411	1110	87	776	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.15e-155	401	1111	192	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.46e-155	414	1115	15	705	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001595	0.998383	CS pos: 16-17. Pr: 0.9556

TMHMM  Annotations     

There is no transmembrane helices in YNR067C-t26_1-p1.