CAZyme Information: YNL066W-t26_1-p1

Basic Information

• Species: Saccharomyces cerevisiae
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Saccharomyces; Saccharomyces cerevisiae
• CAZyme ID: YNL066W-t26_1-p1
• CAZy Family: GT35
• CAZyme Description: putative glucosidase SUN4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	BK006947|CGC5	43442.17	3.9560

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ScerevisiaeS288C	6350	559292	443	5907

• Gene Location: location=BK006947:501515-502777(+)

Full Sequence      

MKLSATTLTAASLIGYSTIVSALPYAADIDTGCTTTAHGSHQHKRAVAVTYVYETVTVDK
NGQTVTPTSTEASSTVASTTTLISESSVTKSSSKVASSSESTEQIATTSSSAQTTLTSSE
TSTSESSVPISTSGSASTSSAASSATGSIYGDLADFSGPYEKFEDGTIPCGQFPSGQGVI
PISWLDEGGWSGVENTDTSTGGSCKEGSYCSYACQPGMSKTQWPSDQPSDGRSIGGLLCK
DGYLYRSNTDTDYLCEWGVDAAYVVSELSNDVAICRTDYPGTENMVIPTYVQAGDSLPLT
VVDQDTYYTWQGLKTSAQYYVNNAGISVEDACVWGSSSSGVGNWAPLNFGAGSSDGVAYL
SLIPNPNNGNALNFNVKIVAADDSSTVNGECIYENGSFSGGSDGCTVSVTAGKAKFVLYN

Enzyme Prediction     

No EC number prediction in YNL066W-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	121	419	4.8e-127	0.9537953795379538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	1.52e-147	165	406	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA60196.1|GH132	2.63e-257	1	420	1	420
AAA99645.1|GH132	2.63e-257	1	420	1	420
CAA95939.1|GH132	2.63e-257	1	420	1	420
QHB11311.1|GH132	2.63e-257	1	420	1	420
NP_014333.1|GH132	2.63e-257	1	420	1	420

PDB Hits     

YNL066W-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53616|SUN4_YEAST	4.68e-258	1	420	1	420	Probable secreted beta-glucosidase SUN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUN4 PE=1 SV=1
sp|P40472|SIM1_YEAST	9.75e-177	148	420	204	476	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2
sp|Q59NP5|SUN41_CANAL	7.90e-137	145	420	143	418	Secreted beta-glucosidase SUN41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUN41 PE=1 SV=2
sp|P46955|NCA3_YEAST	2.82e-122	163	419	81	337	Beta-glucosidase-like protein NCA3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCA3 PE=3 SV=1
sp|B3LRC2|UTH1_YEAS1	2.64e-121	163	419	106	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999730	CS pos: 22-23. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in YNL066W-t26_1-p1.