CAZyme Information: YMR305C-t26_1-p1

Basic Information

• Species: Saccharomyces cerevisiae
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Saccharomyces; Saccharomyces cerevisiae
• CAZyme ID: YMR305C-t26_1-p1
• CAZy Family: GT32
• CAZyme Description: putative family 17 glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		40469.16	4.2499

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ScerevisiaeS288C	6350	559292	443	5907

• Gene Location: location=BK006946:879063-880232(-)

Full Sequence      

MRFSNFLTVSALLTGALGAPAVRHKHEKRDVVTATVHAQVTVVVSGNSGETIVPVNENAV
VATTSSTAVASQATTSTLEPTTSANVVTSQQQTSTLQSSEAASTVGSSTSSSPSSSSSTS
SSASSSASSSISASGAKGITYSPYNDDGSCKSTAQVASDLEQLTGFDNIRLYGVDCSQVE
NVLQAKTSSQKLFLGIYYVDKIQDAVDTIKSAVESYGSWDDITTVSVGNELVNGGSATTT
QVGEYVSTAKSALTSAGYTGSVVSVDTFIAVINNPDLCNYSDYMAVNAHAYFDENTAAQD
AGPWVLEQIERVYTACGGKKDVVITETGWPSKGDTYGEAVPSKANQEAAISSIKSSCGSS
AYLFTAFNDLWKDDGQYGVEKYWGILSSD

Enzyme Prediction     

No EC number prediction in YMR305C-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	138	389	1.9e-32	0.9646302250803859

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	5.49e-121	92	389	1	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	8.37e-11	145	389	11	300	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJS94041.1|GH17	1.32e-239	1	389	1	389
AJS63482.1|GH17	1.32e-239	1	389	1	389
AJS80087.1|GH17	1.32e-239	1	389	1	389
AJS84436.1|GH17	1.32e-239	1	389	1	389
AJS97504.1|GH17	1.32e-239	1	389	1	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.52e-09	138	389	39	285	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q04951|SCW10_YEAST	2.34e-240	1	389	1	389	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	7.10e-137	133	389	130	386	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q59XX2|MP65_CANAL	6.18e-126	133	388	123	378	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|P53189|SCW11_YEAST	2.04e-50	137	386	282	538	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|B0Y9Q9|BTGE_ASPFC	2.14e-48	134	388	306	563	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000420	0.999537	CS pos: 29-30. Pr: 0.4098

TMHMM  Annotations     

There is no transmembrane helices in YMR305C-t26_1-p1.