CAZyme Information: YLR300W-t26_1-p1

Basic Information

• Species: Saccharomyces cerevisiae
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Saccharomyces; Saccharomyces cerevisiae
• CAZyme ID: YLR300W-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448		51310.97	4.3418

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ScerevisiaeS288C	6350	559292	443	5907

• Gene Location: location=BK006945:728955-730301(+)

Full Sequence      

MLSLKTLLCTLLTVSSVLATPVPARDPSSIQFVHEENKKRYYDYDHGSLGEPIRGVNIGG
WLLLEPYITPSLFEAFRTNDDNDEGIPVDEYHFCQYLGKDLAKSRLQSHWSTFYQEQDFA
NIASQGFNLVRIPIGYWAFQTLDDDPYVSGLQESYLDQAIGWARNNSLKVWVDLHGAAGS
QNGFDNSGLRDSYKFLEDSNLAVTTNVLNYILKKYSAEEYLDTVIGIELINEPLGPVLDM
DKMKNDYLAPAYEYLRNNIKSDQVIIIHDAFQPYNYWDDFMTENDGYWGVTIDHHHYQVF
ASDQLERSIDEHIKVACEWGTGVLNESHWTVCGEFAAALTDCTKWLNSVGFGARYDGSWV
NGDQTSSYIGSCANNDDIAYWSDERKENTRRYVEAQLDAFEMRGGWIIWCYKTESSLEWD
AQRLMFNGLFPQPLTDRKYPNQCGTISN

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	108	414	4.2e-126	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.39e-120	36	448	1	399	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	6.68e-06	110	267	19	165	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJV59814.1|GH5_9	0.0	1	448	1	448
AJV54426.1|GH5_9	0.0	1	448	1	448
AJV65593.1|GH5_9	0.0	1	448	1	448
AJV59372.1|GH5_9	0.0	1	448	1	448
AJV74026.1|GH5_9	0.0	1	448	1	448

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H4P_A	4.84e-319	41	448	1	408	Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1EQP_A	4.59e-180	42	444	2	392	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	9.23e-180	42	444	2	392	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	1.14e-179	42	444	8	398	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PBO_A	3.26e-179	42	444	8	398	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23776|EXG1_YEAST	0.0	1	448	1	448	Glucan 1,3-beta-glucosidase I/II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EXG1 PE=1 SV=1
sp|Q876J3|EXG_SACU7	0.0	1	448	1	448	Glucan 1,3-beta-glucosidase OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) OX=659244 GN=EXG1 PE=3 SV=1
sp|Q875R9|EXG_LACK1	1.17e-242	18	444	17	438	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1
sp|Q876J2|SPR1_SACU7	5.61e-226	21	443	22	444	Sporulation-specific glucan 1,3-beta-glucosidase OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) OX=659244 GN=SPR1 PE=3 SV=1
sp|P32603|SPR1_YEAST	5.61e-226	10	443	11	444	Sporulation-specific glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPR1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000261	0.999689	CS pos: 24-25. Pr: 0.7696

TMHMM  Annotations     

There is no transmembrane helices in YLR300W-t26_1-p1.