CAZyme Information: YLR273C-t26_1-p1

Basic Information

• Species: Saccharomyces cerevisiae
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Saccharomyces; Saccharomyces cerevisiae
• CAZyme ID: YLR273C-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: protein phosphatase regulator PIG1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
648	BK006945|CGC1	74146.30	4.8721

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ScerevisiaeS288C	6350	559292	443	5907

• Gene Location: location=BK006945:689083-691029(-)

Full Sequence      

MPYSHGKKLKPSLKLAKTISTSSFVSSTTSNSFSPLEDSTSASSSTSSSSSGKSVRFAAH
LYTVKKFNTKLAPISISEKAASNLTRNLHNNAIPLTFPFIGGEDHRYSLDILDYSDLEYD
NKDVEYDNESDVEDNAMLMHDRSMFIEKEILCFGEEETFDMADWKLVSNNLNPFKSDYKV
DVTGLEDKIFKYLNGQNIKVHSLELSDPVSYEDICSNNFGNCQIWGLIFVNNLNFEKKIE
IKFTLNNWADIHYINAHYNKSVTPHVDEFKFIIDISALKLNLISKNLIYTNFFERKTTCL
LNLQFCCRYDVNGFEYRSFYDNNDYKNYEITISLSAINLNRAVSNSSIFNSNLGPSKMGA
SNAEVTMSKNNENSKKPLRKFIKDTDYYNDSPLKHKFYQSFETKAACKTEPVSQTFKAET
IDCEIEPFNYFFEPPDSQTNEDMSDSSYDLSLQDFNYWEFSNHGLGKALADSDILQFKNY
PKPEPFSRPPIIDDTFTLNTDDRTLGSKTQKLEDNLAKEWKSAKTRTTLNETPLHDDEHR
TSFTYTTWNNSTDTLMKRKEERPVESASCSQLSIATIKAEEDLLYQDYINSGRESSSPEI
SPLNTTTSLPFFPGDNMSDSSGEYEERTSLSPNKIHIFRDYFYKSPSP

Enzyme Prediction     

No EC number prediction in YLR273C-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	208	330	6.1e-26	0.9626168224299065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	2.14e-25	192	331	1	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJV81128.1|CBM21	0.0	1	648	1	648
AAB67365.1|CBM21	0.0	1	648	1	648
AJV75743.1|CBM21	0.0	1	648	1	648
AJV49039.1|CBM21	0.0	1	648	1	648
AJV81582.1|CBM21	0.0	1	648	1	648

PDB Hits     

YLR273C-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q06216|PIG1_YEAST	0.0	1	648	1	648	Serine/threonine-protein phosphatase 1 regulatory subunit PIG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIG1 PE=1 SV=1
sp|P28006|GAC1_YEAST	1.71e-41	53	398	69	431	Serine/threonine-protein phosphatase 1 regulatory subunit GAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAC1 PE=1 SV=2
sp|Q5U2R5|PPR3C_RAT	4.37e-06	206	330	143	256	Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
sp|P40187|PIG2_YEAST	7.40e-06	182	332	359	509	GSY2-interacting protein PIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIG2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in YLR273C-t26_1-p1.