CAZyme Information: YJL116C-t26_1-p1

Basic Information

• Species: Saccharomyces cerevisiae
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Saccharomyces; Saccharomyces cerevisiae
• CAZyme ID: YJL116C-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: SUN family protein NCA3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	BK006943|CGC6	35412.47	4.0367

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ScerevisiaeS288C	6350	559292	443	5907

• Gene Location: location=BK006943:193860-194873(-)

Full Sequence      

MKISAALILSSLSSVAFSAPAPAPADSHHEDHHKDEKPAVVTVTQYIDSNAATSTVESAA
TTTTLSSSEKDTSEQKRDGGFQDGTVKCSDFPSVNGIVSLDWLGFGGWASVMDMDANTSS
ECKDGYYCSYACEPGMSKTQWPSDQPSDGKSVGGLYCKNGYLYRTNTDTSDLCSTDETSA
KAINKKSDSIALCRTDYPGSENMVIPTVVDGGDSQPISVVDEDTYYQWQGKKTSAQYYIN
NAGVSAEDGCIWGTSGSDVGNWAPLVLGAGSTNGETYLSLIPNPNSNQAANFNVKIVASD
GANVQGSCAYEDGSFTGDGSDGCTVSVLSGSAEFVFY

Enzyme Prediction     

No EC number prediction in YJL116C-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	49	337	5.2e-129	0.9603960396039604

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	2.48e-147	83	324	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAY80669.2|GH132	2.42e-234	1	337	1	337
AJR57453.1|GH132	2.42e-234	1	337	1	337
AJR70737.1|GH132	2.42e-234	1	337	1	337
AJR66522.1|GH132	2.42e-234	1	337	1	337
AJR69410.1|GH132	2.42e-234	1	337	1	337

PDB Hits     

YJL116C-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46955|NCA3_YEAST	4.30e-235	1	337	1	337	Beta-glucosidase-like protein NCA3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCA3 PE=3 SV=1
sp|B3LRC2|UTH1_YEAS1	8.23e-146	79	337	104	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1
sp|A7A003|UTH1_YEAS7	8.23e-146	79	337	104	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=UTH1 PE=3 SV=2
sp|B5VMJ0|UTH1_YEAS6	8.23e-146	79	337	104	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain AWRI1631) OX=545124 GN=UTH1 PE=3 SV=2
sp|P36135|UTH1_YEAST	9.13e-146	79	337	107	365	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTH1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000251	0.999689	CS pos: 18-19. Pr: 0.9799

TMHMM  Annotations     

There is no transmembrane helices in YJL116C-t26_1-p1.