CAZyme Information: YDR307W-t26_1-p1

Basic Information

• Species: Saccharomyces cerevisiae
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Saccharomyces; Saccharomyces cerevisiae
• CAZyme ID: YDR307W-t26_1-p1
• CAZy Family: GH13
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
662	BK006938|CGC2	77569.61	6.7576

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ScerevisiaeS288C	6350	559292	443	5907

• Gene Location: location=BK006938:1075865-1077853(+)

Full Sequence      

MKDLRLQGPYRKYIPYNIFQQCGIGHLKTLDYIFAFLIVITNFTLIWKSHSSSFWNRPWD
NNSEQELSQLIQFYLDKAFYIHELPPFTIQFYSIIRRLKIAENLRYVSLFLNSSTLGFLF
LITRRINCSRLISATGLLILSNWETFRNEGTIISFDSLEWCLFSVVIYSFISISIAKLGT
TNWFANVITLSISLGLAISSKFIGIVTWAFVILSFVRQFDRLISDVKVTTIQIIKFVILC
LLFVLIIPGSIFIISYSNLLSNFKTDTPQFSKYMSTYFKSYLRGPQVQPSRLYYGSTITL
RHLDSMVGYLASHDISYPSDVDEQLVALSFEEFAADNEWLIEHPTLNLSFSEVYHADQLI
PVEFGQSIKLRHKSTGKLLRASTAKPPISEQDYDFQISCTKDSNYEGGMDERWDVLLIKD
EINNDKKDNADDKYIKPLQSEIRFYNNGQRCGLLGHDLRLPEWGRFEQEVLCMEYPVIPR
TTFLIDSVQLPVDFQVPMIEYYIGKISSSAEFNHTLSWSQFLYLFKEYIFKQYKYNYYIK
YGKNKVTFEDAFAVEKWPITLDTDSPVWFNFAWYGSLLSMIIFMCVQCKRMISWNPWTTA
EPSFSIKWEVYNEFGWECIVGWFLHFYIFTMSPHFNLGKKLYFQSFFFSVLCLLESLDCL
AK

Enzyme Prediction     

EC	2.4.1.109:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	74	257	6.2e-17	0.8340807174887892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	1	661	1	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
197746	MIR	9.61e-08	292	344	4	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.
197746	MIR	1.10e-06	440	488	8	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.
396786	PMT	3.16e-05	104	253	85	234	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
197746	MIR	4.43e-05	360	418	2	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJU74269.1|GT39	0.0	1	662	1	662
AAB64743.1|GT39|2.4.1.109	0.0	1	662	1	662
AJU69328.1|GT39	0.0	1	662	1	662
QHB07768.1|GT39	0.0	1	662	1	662
AJU77111.1|GT39	0.0	1	662	1	662

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	1.48e-22	164	472	197	498	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	2.91e-11	144	501	191	548	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P28_A	2.30e-09	310	476	25	179	Crystal structure of the MIR domain (aa 337-532) of the S. cerevisiae mannosyltransferase Pmt2 [Saccharomyces cerevisiae]
6ZQP_A	3.06e-09	283	476	17	196	Structure of the Pmt2-MIR domain with bound ligands [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q06644|PMT7_YEAST	0.0	1	662	1	662	Probable dolichyl-phosphate-mannose--protein mannosyltransferase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT7 PE=1 SV=1
sp|Q5ACU3|PMT5_CANAL	1.18e-39	67	658	84	665	Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT5 PE=2 SV=1
sp|O74189|PMT1_CANAL	2.42e-25	135	653	186	682	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT1 PE=2 SV=1
sp|P33775|PMT1_YEAST	7.61e-22	164	472	197	498	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT1 PE=1 SV=1
sp|O13898|PMT1_SCHPO	2.17e-19	182	625	202	624	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000008

TMHMM  Annotations     

Start	End
30	47
106	123
162	184
194	216
236	258