CAZyme Information: YBR199W-t26_1-p1

Basic Information

• Species: Saccharomyces cerevisiae
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Saccharomyces; Saccharomyces cerevisiae
• CAZyme ID: YBR199W-t26_1-p1
• CAZy Family: CBM48
• CAZyme Description: putative mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464		54555.99	4.4673

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ScerevisiaeS288C	6350	559292	443	5907

• Gene Location: location=BK006936:618909-620303(+)

Full Sequence      

MRFLSKRILKPVLSVIILISIAVTVVLYFLTANENYLQAVKDSAKSQYASLRESYKSITG
KTESADELPDHDAEVLDSIMDRLHEPLYEKDTFDPNEVLAENKQLYEEFLLQEISEPKVD
NLVRSGDPLAGKAKGTILSLVRNSDLEDIISSIQQLEEEYNKNFGYPYTFLNDEEFTDEF
KDGIKSILPKDRVVEFGTIGPDNWNMPDSIDRERYDQEMDKMSKENIQYAEVESYHNMCR
FYSKEFYHHPLLSKYKYVWRLEPNVNFYCKINYDVFQFMNKNDKIYGFVLNLYDSPQTIE
TLWTSTMDFVEEHPNYLNVNGAFAWLKDNSQNPKNYDYTQGYSTCHFWTNFEIVDLDFLR
SEPYEKYMQYLEEKGGFYYERWGDAPVRSLALALFADKSSIHWFRDIGYHHTPYTNCPTC
PADSDRCNGNCVPGKFTPWSDLDNQNCQATWIRHSMSEEELEMY

Enzyme Prediction     

EC	2.4.1.131:20	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT15	132	412	8.1e-114	0.9926739926739927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227353	KTR1	1.03e-174	10	464	1	399	Mannosyltransferase [Carbohydrate transport and metabolism].
396385	Glyco_transf_15	5.07e-132	91	413	1	313	Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJP89814.1|GT15	0.0	1	464	1	464
AJP84101.1|GT15	0.0	1	464	1	464
CAD6600417.1|GT15	0.0	1	464	1	464
AJQ07451.1|GT15	0.0	1	464	1	464
AJP83726.1|GT15	0.0	1	464	1	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A07_A	0.0	33	464	3	434	X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A07_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A08_A X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C],5A08_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C]
7BOO_A	8.61e-103	120	454	54	382	Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOP_A Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163]
1S4N_A	4.67e-86	130	418	24	301	Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4N_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4O_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4O_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4P_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae],1S4P_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38131|KTR4_YEAST	0.0	1	464	1	464	Probable mannosyltransferase KTR4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR4 PE=1 SV=1
sp|Q00310|MNT1_CANAL	3.41e-89	129	439	105	405	Glycolipid 2-alpha-mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT1 PE=3 SV=1
sp|P46592|MNT2_CANAL	4.99e-87	125	421	131	418	Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT2 PE=3 SV=4
sp|O60160|OMH1_SCHPO	1.09e-85	132	443	69	371	O-glycoside alpha-1,2-mannosyltransferase omh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh1 PE=3 SV=1
sp|P27809|KRE2_YEAST	3.91e-84	130	418	118	395	Glycolipid 2-alpha-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.916541	0.083476

TMHMM  Annotations     

Start	End
12	31