CAZyme Information: YBR038W-t26_1-p1

Basic Information

• Species: Saccharomyces cerevisiae
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Saccharomyces; Saccharomyces cerevisiae
• CAZyme ID: YBR038W-t26_1-p1
• CAZy Family: AA6
• CAZyme Description: chitin synthase CHS2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
963	BK006936|CGC6	109881.62	8.8394

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ScerevisiaeS288C	6350	559292	443	5907

• Gene Location: location=BK006936:311898-314789(+)

Full Sequence      

MTRNPFMVEPSNGSPNRRGASNLSKFYANANSNSRWANPSEESLEDSYDQSNVFQGLPAS
PSRAALRYSPDRRHRTQFYRDSAHNSPVAPNRYAANLQESPKRAGEAVIHLSEGSNLYPR
DNADLPVDPYHLSPQQQPSNNLFGSGRLYSQSSKYTMSTTSTTAPSLAEADDEKEKYLTS
TTSYDDQSTIFSADTFNETKFELNHPTRQQYVRRANSESKRRMVSDLPPPSKKKALLKLD
NPIPKGLLDTLPRRNSPEFTEMRYTACTVEPDDFLREGYTLRFAEMNRECQIAICITMYN
EDKYSLARTIHSIMKNVAHLCKREKSHVWGPNGWKKVSVILISDGRAKVNQGSLDYLAAL
GVYQEDMAKASVNGDPVKAHIFELTTQVSINADLDYVSKDIVPVQLVFCLKEENKKKINS
HRWLFNAFCPVLQPTVVTLVDVGTRLNNTAIYRLWKVFDMDSNVAGAAGQIKTMKGKWGL
KLFNPLVASQNFEYKISNILDKPLESVFGYISVLPGALSAYRYRALKNHEDGTGPLRSYF
LGETQEGRDHDVFTANMYLAEDRILCWELVAKRDAKWVLKYVKEATGETDVPEDVSEFIS
QRRRWLNGAMFAAIYAQLHFYQIWKTKHSVVRKFFLHVEFLYQFIQMLFSWFSIANFVLT
FYYLAGSMNLVIKHGEALFIFFKYLIFCDLASLFIISMGNRPQGAKHLFITSMVILSICA
TYSLICGFVFAFKSLASGTESHKIFVDIVISLLSTYGLYFFSSLMYLDPWHMFTSSIQYF
LTLPAFTCTLQIFAFCNTHDVSWGTKGSTQESKQLSKAIVVQGPDGKQIVETDWPQEVDK
KFLEIKSRLKEPEFEESSGNEKQSKNDYYRDIRTRIVMIWMLSNLILIMSIIQVFTPQDT
DNGYLIFILWSVAALAAFRVVGSMAFLFMKYLRIIVSYRNKVEGSGSWEVSKLDLPNVFH
KKG

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	298	458	1e-69	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	1.38e-100	294	612	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
396286	Chitin_synth_1	2.25e-96	298	458	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
224136	BcsA	1.28e-34	401	815	109	431	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
400626	Chitin_synth_1N	1.50e-28	237	297	9	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
133045	CESA_like	8.43e-18	296	543	3	179	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJP84332.1|GT2	0.0	1	963	1	963
AJP89282.1|GT2	0.0	1	963	1	963
AJP89658.1|GT2	0.0	1	963	1	963
AJP98108.1|GT2	0.0	1	963	1	963
AJP83184.1|GT2	0.0	1	963	1	963

PDB Hits     

YBR038W-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14180|CHS2_YEAST	0.0	1	963	1	963	Chitin synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHS2 PE=1 SV=1
sp|P23316|CHS1_CANAX	2.24e-280	237	941	31	761	Chitin synthase 1 OS=Candida albicans OX=5476 GN=CHS1 PE=2 SV=2
sp|P30584|CHSA_EMENI	7.65e-253	239	958	237	968	Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsA PE=3 SV=2
sp|P30589|CHS2_NEUCR	5.18e-246	237	939	335	1058	Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-2 PE=3 SV=4
sp|Q92444|CHS2_PARBR	5.56e-243	237	946	252	979	Chitin synthase 2 OS=Paracoccidioides brasiliensis OX=121759 GN=CHS2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000000

TMHMM  Annotations     

Start	End
642	664
677	699
709	731
744	766
776	798
876	896
906	928