CAZyme Information: YALI1_F08075g-t41_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI1_F08075g-t41_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		48274.71	4.8260

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB89W29	8746	N/A	797	7949

• Gene Location: location=CP017558:807577-808842(+)

Full Sequence      

MKLTKLVALAGAALASPIQLVPREGSFLGFNYGSEKVHGVNLGGWFVLEPFITPSLFEAF
GNNDANVPVDEYHYTAWLGKEEAEKRLTDHWNTWITEYDIKAIAENYKLNLVRIPIGYWA
FSLLPNDPYVQGQEAYLDRALGWCRKYGVKAWVDVHGVPGSQNGFDNSGLRDHWDWPNAD
NVQHSINVINYIAGKYGAPEYNDIVVGIELVNEPLGPAIGMEVIEKYFQEGFWTVRHAGS
DTAVVIHDAFQEKNYFNNFMTTEQGFWNVVLDHHQYQVFSPGELARNIDQHIAEVCNVGR
QASTEYHWRIFGEWSAALTDCTHWLNGVGKGPRLDGSFPGSYYQRSCQGRGDIQTWSEQD
KQESRRYVEAQLDAWEHGGDGWIYWTYKTENALEWDFRRLVDNGIFPFPYWDRQFPNQCG
F

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	89	390	1.1e-120	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	5.99e-67	31	420	12	395	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	9.06e-07	94	246	24	165	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNQ00559.1|GH5_9	0.0	1	421	1	421
CAG77837.1|GH5_9	0.0	1	421	1	421
AOW06699.1|GH5_9	0.0	1	421	1	421
CAA86952.1|GH5_9	0.0	1	421	1	421
ANB12754.1|GH5_9	3.57e-179	4	421	8	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	2.37e-180	30	421	2	393	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PB1_A	5.91e-180	25	421	3	399	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
1CZ1_A	6.77e-180	30	421	2	393	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PC8_A	1.69e-179	25	421	3	399	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PBO_A	1.69e-179	25	421	3	399	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12725|EXG_YARLI	0.0	1	421	1	421	Glucan 1,3-beta-glucosidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=EXG1 PE=3 SV=2
sp|P29717|EXG1_CANAL	2.87e-179	25	421	41	437	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q12700|EXG_SCHOC	1.31e-174	15	421	23	425	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|O93983|EXG2_WICAO	6.19e-171	8	419	10	426	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1
sp|Q875R9|EXG_LACK1	3.86e-165	30	421	41	439	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000298	0.999634	CS pos: 23-24. Pr: 0.9553

TMHMM  Annotations     

There is no transmembrane helices in YALI1_F08075g-t41_1-p1.