CAZyme Information: YALI1_F02592g-t41_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI1_F02592g-t41_1-p1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862	CP017558|CGC2	94583.34	5.7649

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB89W29	8746	N/A	797	7949

• Gene Location: location=CP017558:259239-261827(+)

Full Sequence      

MFGGGEKKDDQIYKEGRGLFHKSTHSQQTTSNMPIDVQNTLEQLELSEKIALTAGVDIWH
TVPIERLGVPSARTSDGPNGIRGTQFFNSEPAACLPASLGLGATWDQDLLYQVGELLAEE
SRAKSAHVVLAPTINIQRSPLGGRSFESFSEDPLLSGKLATQYVKGLQDNKVAACIKHFV
TNDQENGRMGSNSVVTDRALREIYLKPFEIAVREANPKAFMTAYNKLNGTHVSEHDILGS
VLRGEWKWRGLVMSDWFGTYSTSDAVNAGLDLEMPGPPRWRGEQLTHAVLSNKVTTETLD
ERVTNVLELVKYAQESGIPFNGPESTNNTPKTRALLRKLVADSTVLLKNDANILPLDKTK
KVAVIGPNAKATAFCGGGSASLRPYYTVSPFEGITSKTGSEPDYAVGAYAHKELPDFASY
LKSESGDEGIWDVRFYNDKRGAQDRKCFDQLTIEQTKLFLFDYSHKDIPKNKIFYVDATA
TLKVPKDGVYDFGMTLLGTAKFFVDDKCVLDCTKDQENGNSFFGEGTKEKIGSIELKANK
DYAIRLEFGSEATSPRERGGLVSNGGGAVQAGMARQAAAEDTIAEAVELAKRSEQVILFS
GLNMAWESEGFDRPNLSLPPHNDALIEAVLDANPNTVIVIQSGAPVEMPWASTAKTIVHA
TFGGNETGNGIADVLFGDVNPSAKLPITYPLKVQHTPSYYNFGHPKRTLYGEDVFVGYRH
YEKVDREVLFPFGHGLSYTSFELSNLSVSKKDDTVTVTVNVKNTGSKTGAEIVQVYVSQE
KPSIVRPVKELRGFSKVELDAGKSDTVTVELDVDQATSFWNEYISKWTSEADKYHIHVGT
SSAGKHLEGEFEVKKTKNWLGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	64	275	7.9e-68	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.50e-89	66	852	101	763	beta-glucosidase BglX.
224389	BglX	2.69e-71	57	370	48	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.38e-55	344	718	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	6.33e-48	29	822	45	753	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	8.25e-42	40	309	44	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG77673.1|GH3	0.0	1	862	1	862
AOW06499.1|GH3	0.0	1	862	1	862
QNQ00483.1|GH3	0.0	33	862	1	830
AJA36818.1|GH3	4.43e-316	35	862	4	838
ATQ35958.1|GH3	1.98e-312	36	862	5	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	4.50e-275	36	862	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.07e-270	36	862	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.79e-148	33	856	1	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.79e-119	40	842	8	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	3.59e-108	43	843	60	818	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WU49|BGLI_ASPFU	7.88e-317	35	862	4	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	7.88e-317	35	862	4	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	3.65e-315	36	862	5	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	7.33e-315	35	862	4	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	4.96e-308	35	862	4	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000016

TMHMM  Annotations     

There is no transmembrane helices in YALI1_F02592g-t41_1-p1.