CAZyme Information: YALI1_E15093g-t41_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI1_E15093g-t41_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		38672.67	5.6170

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB89W29	8746	N/A	797	7949

• Gene Location: location=CP017557:1509275-1510276(+)

Full Sequence      

MKEELEEARKRKEERRKKAQEQKSEKLQGIFHKLEGEEIGSIVNKPLTYTDEEKVDGHVQ
PYGPKIALLSASNGKTDNEMAMLELVLPNRQEYCNYHGYICAFVDLNTVDTGSDHVVWAK
MGAIQRVFDEHPEVEWVWWMDTDIFLMNPEIELGEHLLSDRALVERLTYARPIRKPDATF
DGEVYPSKDNPPKPENLNLLLTQDFFGINAGSFFIKRSPWTDMLLDLWYDPVHVEKNYIF
KEQEALNNLIRGHKSILSHTGIYPQRLFNSYTGEPNDVWTYKEGDLALHLAGCNHNNDCE
KHLTGYFPQRVRVPEKYRESGLRVDFGKKKEGN

Enzyme Prediction     

No EC number prediction in YALI1_E15093g-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	64	301	1.4e-70	0.9878048780487805

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	3.10e-64	64	299	3	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	6.38e-14	64	228	127	265	xyloglucan 6-xylosyltransferase; Provisional
215616	PLN03181	9.64e-09	87	228	154	266	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW05314.1|GT34	2.89e-249	1	333	1	333
QNP98931.1|GT34	7.13e-237	26	333	259	566
CAG79446.1|GT34	1.26e-236	26	333	275	582
QNP98707.1|GT34	7.55e-130	27	318	267	558
AOW04789.1|GT34	1.45e-128	27	318	368	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BSU_A	1.12e-11	59	228	29	172	Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSU_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10359|GMH3_SCHPO	1.62e-49	25	300	40	321	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1
sp|O94622|YBKD_SCHPO	3.22e-44	61	306	99	346	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	3.57e-42	61	306	99	346	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q09679|GMH1_SCHPO	2.95e-39	60	306	81	324	Probable alpha-1,2-galactosyltransferase gmh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh1 PE=3 SV=1
sp|P50108|MNN10_YEAST	2.29e-35	64	317	120	386	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in YALI1_E15093g-t41_1-p1.