CAZyme Information: YALI1_E07121g-t41_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI1_E07121g-t41_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
741		84490.96	9.0829

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB89W29	8746	N/A	797	7949

• Gene Location: location=CP017557:712141-714366(+)

Full Sequence      

MAELRNRKGGVAAEPAAADSTPKVMVKPKKKSNAKYFQANLVLTLLAFLTRFIMLSHPDE
VVFDEVHFGKFASYYLQRTYFFDLHPPFAKLLIAAVGWLIGYDGSFKFENIGENYITNNV
PYVAYRALSASLGSLTVPIIFKTLQYSGYSVAACTIGAAIVCLDNAHINDSRLILLDATL
NISVALSLFCYVRFSNQRKSPFSLAWWTWLFSTGIALSCTISTKYVGVFTFMAVGGAVVY
DLWLLLDYEKSGLSMKDFLWHFGARAYALILVPFVIYLAWFQVHFVVLNRSGPGDAFMSP
DFQETLGDNFLAQQARDVEFYDIVRFKHKSTGALLHSHDARYPLRYEDGRISSQGQQVTG
YSTADPNNAWQILPEKDFPEDQRVGHPVYGSNKVRFRHLATNTYLLTHDVASPYFPTNQE
FTTVSPEVAAERYNETIFEVRLNTGKSNNVRTKAAEFKLIHDKTKVAMWSHSKLLPEWGF
GQFEINGNKNTQDPTNTWTFDEIVGLSPERAAFTPKKTRQIPFLQKYLELQGTMFRENNA
LTASHPYASEPITWPFLIRGVSFWTNAPNRAQIYFHGNFVGWYIEDIVIALFVGAIAADQ
FMRKRQITTFGRRASSKLYHSMGFFFLAWSTHFFPFFLMGRQKFLHHYLPAHLCAALLAG
AGFDFIFGEFDRLDEEANASKKDLEYTQRKNKPLHLATITVLILLTACFLFFCPLTYGLA
NQSVQAIQWRQWMKFELHFSK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	43	285	4.6e-69	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	35	729	22	689	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.42e-80	42	289	2	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	5.81e-65	525	734	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	3.48e-16	334	481	11	164	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	5.31e-11	316	374	2	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW05017.1|GT39	0.0	1	741	1	741
CAG79188.1|GT39	0.0	1	741	1	741
QNP98818.1|GT39	0.0	1	741	1	741
ANB13845.1|GT39	1.52e-300	3	741	4	751
QMW29154.1|GT39	3.62e-285	4	741	9	775

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	3.11e-95	11	729	30	723	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	3.49e-94	42	723	70	739	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
1T9F_A	4.69e-08	318	431	7	112	Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function [Caenorhabditis elegans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	1.18e-263	28	741	39	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	2.92e-253	25	741	41	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|O42933|PMT4_SCHPO	1.84e-221	30	733	51	767	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|F1Q8R9|POMT2_DANRE	1.48e-97	28	734	60	752	Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1
sp|O74189|PMT1_CANAL	2.70e-95	22	668	51	691	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999982	0.000029

TMHMM  Annotations     

Start	End
36	55
80	102
122	141
146	168
173	195
205	222
227	246
266	288
579	598
618	640
645	667
699	721