CAZyme Information: YALI1_D28351g-t41_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI1_D28351g-t41_1-p1
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
979		97612.06	4.2471

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB89W29	8746	N/A	797	7949

• Gene Location: location=CP017556:2832086-2835025(-)

Full Sequence      

MKFSTIANFGASLMSLATSVAAFDPAGSNNVVLYWGQASAGSQEPLGSYCESNAADVYVV
SFLNSFNGNGDLTLTISGCNDNFAGGLANCPAIAADIKKCQSLGKKVFISLGGAVGSYGF
TSDAGGANFADTLWNTFGGGTAAERPFGDAIVDGYDLDIENQQQMGYVALVKRLREHFAS
SSGQYYISATPQCPYPDASVGEALAGADIDFAYVQFYNNYCGVNNPGQFNFDTWDNFAKT
VSPNKNIKIYLGVPGAVSAASTGYIDGATLKSYVDKVKQYSSFGGIMMWDASQAFLNKEG
GVSYAQIAKNALGGAGPVVSVASTPVVSVASSSAWAPSSASVWTPESSSAPAPAPWAPSS
APAPAPWAPSSAPAPGAPAPAVSSPAPWAPSSAPAPAPVSTHTPDNGMWKPENGPSVVSS
LAAPSGPVFAAESGSVESGVEADTTVTEQHTVTSVGETVTTTVPTAVETSEISSAAEAAA
ETSSIPESSPSSSKAKHTVYHTTIESVYIDTTVVNVPGPSPTSEGVSTSEGVAEGVVPSS
GASPSSASPSGASPSVSPSSVASLAAPSNPAFAAESGEIKNKSENAASGTSSVAGAPSSA
AGPALSASPAPSSSAELTTTTTSSVFTTKTLTGTTVSVSGEAAAEETSESSAETPEASQT
SESAPVSSETAVETTPISSEAAAAVETGASAPASSTPASSTPAPASSAPVSSAPAPAPAP
SKVSKVAPSDLLSQATTVSASATAATISLADSAPQKTISPESAHPPCDGKQGNDLAKCLN
GIYGNQEVISKLSVQDKQKPVPTDAAASEAAAPTGGATASEASPSPASPTDAGKPAEKPA
EKPADKPAEDPAEKPATSSAASSAASASAPTSAADKPSSDTPSTSKPLADSGCTEGEVGC
SPAGEFIMCNFNKWVHFACPPTTTCFAIASGKNAVVGCNYIDAPIPLIKRSDQSLISHRP
PPTLQQRRQNNVDVFAMLK

Enzyme Prediction     

EC	3.2.1.14:12	3.2.1.14:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	29	304	4.1e-24	0.9695945945945946
CBM19	884	926	5.8e-19	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	5.81e-119	29	310	1	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
119349	GH18_chitinase-like	4.77e-17	31	293	1	209	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119350	GH18_chitinase_D-like	8.23e-14	34	289	6	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
119363	GH18_CTS3_chitinase	1.14e-11	101	290	69	252	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
226000	Chi1	1.37e-08	95	313	89	326	Chitinase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW04459.1|CBM19|GH18	0.0	1	979	1	979
CAG81347.1|CBM19|GH18	0.0	1	979	1	979
QNP98256.1|CBM19|GH18	0.0	1	979	1	972
CDR43229.1|CBM19|GH18	1.15e-107	4	314	5	315
ANB14961.1|CBM19|GH18	3.93e-107	9	314	3	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2UY2_A	2.06e-103	24	312	1	287	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2GSJ_A	7.94e-45	31	290	3	254	cDNA cloning and 1.75A crystal structure determination of PPL2, a novel chimerolectin from Parkia platycephala seeds exhibiting endochitinolytic activity [Parkia platycephala]
1HVQ_A	1.16e-42	31	289	3	255	CRYSTAL STRUCTURES OF HEVAMINE, A PLANT DEFENCE PROTEIN WITH CHITINASE AND LYSOZYME ACTIVITY, AND ITS COMPLEX WITH AN INHIBITOR [Hevea brasiliensis],1LLO_A Chain A, HEVAMINE [Hevea brasiliensis],2HVM_A Hevamine A At 1.8 Angstrom Resolution [Hevea brasiliensis]
2XVN_A	5.59e-42	29	312	1	307	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
4TX6_A	5.73e-42	29	312	2	308	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P29029|CHIT_YEAST	2.21e-100	22	312	20	308	Endochitinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTS1 PE=1 SV=2
sp|Q5AAH2|CHI1_CANAL	1.15e-84	26	316	15	292	Chitinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CHT1 PE=1 SV=1
sp|P46876|CHI1_CANAX	1.59e-84	26	316	15	292	Chitinase 1 OS=Candida albicans OX=5476 GN=CHT1 PE=3 SV=2
sp|P29027|CHI2_RHIOL	1.38e-81	30	297	30	300	Chitinase 2 OS=Rhizopus oligosporus OX=4847 GN=CHI2 PE=1 SV=1
sp|P29026|CHI1_RHIOL	1.82e-81	5	297	5	300	Chitinase 1 OS=Rhizopus oligosporus OX=4847 GN=CHI1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000213	0.999779	CS pos: 22-23. Pr: 0.9643

TMHMM  Annotations     

There is no transmembrane helices in YALI1_D28351g-t41_1-p1.