CAZyme Information: YALI1_C29104g-t41_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI1_C29104g-t41_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547	CP017555|CGC3	60468.66	4.6167

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB89W29	8746	N/A	797	7949

• Gene Location: location=CP017555:2908797-2910440(-)

Full Sequence      

MAYCTLLSSDNYLPGAIVLGHRLKTLDSSRDRLCLITKAVSPHIKQELAQYYSSVFLVDD
ILPYNDSSRAAQQLLGRPELGTTLAKIAVWNLTQYRQILFLDSDVLPLKDISILFKVLQN
QSNSGKPVLVASPDVGWPDVFNSGVFATVPDQNVYSTLVELAQSGISFDGGDQGLLNEYF
REVNPFSTSSEPDGSWVRAPFTFNVPANGAGVGSGVASGAGAGPGAGLGSGAAGYEPAYT
RFKNEVSAVHFLGPGNKPWMSSRGSFNDYHVAWNRAYNELYPYVKPSELADSLRNKRTIG
ADINRWDPSIMPPPARGVGEAVKLQQTEFRNVWDANHTAPSPAPSHEHHHHHPPHHHSGS
HHHHHHSDKSQKHAPSAPPPIFPWERKNRVVTRVFDDYVVPPYAEFVAPEEIVDDEEEDE
YEYVEDDVVEVDGEVDDIVEGMSFSLNDISEDDDEYTPSGGKKIAYPVTPFASIRGRRPT
GLPGVAPEFEDDEEEGGEVVNDIRMRRTSEDEYGSTDEWDPSLKLEELRRASDRLSSSQT
SYVPDDI

Enzyme Prediction     

EC	2.4.1.186:40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	3	261	4.1e-37	0.8715953307392996

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	1.37e-78	1	280	1	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
132996	Glyco_transf_8	1.06e-14	1	259	1	244	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
279798	Glyco_transf_8	2.61e-09	4	259	2	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
133064	GT8_GNT1	1.44e-07	2	184	2	174	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
227884	Gnt1	5.87e-04	10	115	81	188	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW03181.1|GT8	0.0	1	547	1	547
CAG82393.1|GT8	0.0	1	547	1	547
QNP96098.1|GT8	0.0	1	547	1	547
CDS13013.1|GT8	1.16e-42	2	295	3	265
CDR45694.1|GT8	1.76e-41	2	396	4	328

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ZCT_A	3.39e-32	2	259	25	240	structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus],1ZCT_B structure of glycogenin truncated at residue 270 in a complex with UDP [Oryctolagus cuniculus]
3V8Y_A	3.47e-32	2	259	25	240	Structure of apo-glycogenin truncated at residue 270 [Oryctolagus cuniculus],3V8Z_A Structure of apo-glycogenin truncated at residue 270 complexed with UDP [Oryctolagus cuniculus]
3USR_A	3.47e-32	2	259	25	240	Structure of Y194F glycogenin mutant truncated at residue 270 [Oryctolagus cuniculus]
1LL2_A	8.44e-32	2	259	5	220	Crystal Structure of Rabbit Muscle Glycogenin Complexed with UDP-glucose and Manganese [Oryctolagus cuniculus],1LL3_A Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus]
1LL0_A	9.50e-32	2	259	11	226	Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_B Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_C Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_D Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_E Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_F Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_G Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_H Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_I Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus],1LL0_J Crystal Structure of Rabbit Muscle Glycogenin [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|H2KYQ5|GYG1_CAEEL	6.08e-36	2	278	4	239	Glycogenin-1 OS=Caenorhabditis elegans OX=6239 GN=gyg-1 PE=1 SV=1
sp|Q9R062|GLYG_MOUSE	1.69e-31	2	259	5	220	Glycogenin-1 OS=Mus musculus OX=10090 GN=Gyg1 PE=1 SV=3
sp|O08730|GLYG_RAT	1.69e-31	2	259	5	220	Glycogenin-1 OS=Rattus norvegicus OX=10116 GN=Gyg1 PE=2 SV=4
sp|P36143|GLG1_YEAST	2.74e-31	1	348	5	346	Glycogenin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLG1 PE=1 SV=4
sp|A6ZQJ2|GLG2_YEAS7	2.97e-31	1	281	5	280	Glycogenin-2 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=GLG2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in YALI1_C29104g-t41_1-p1.