CAZyme Information: YALI1_C05264g-t41_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI1_C05264g-t41_1-p1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473		53616.97	5.7966

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB89W29	8746	N/A	797	7949

• Gene Location: location=CP017555:526426-527847(+)

Full Sequence      

MTLPKSNMFDRNQGGLAPSTRKTLGLVSVFGTALYLCLSILSWVFSGELALVPFTSSSLP
PMADLGIDSVHHYDLADYTGSARGQDRNERVLFLVPLRDAAAHLPMLFAHMDKMTYPHVL
IDLAFLVSDSKDDTMGVLLKELNTLQSNRDVSKRFGSIEIFEKDFGQAVGQGFSDRHGFE
AQGPRRKLMARARNWLLSVALRPDHSWVYWRDADVEKVPTTIMEDLMSHDKDVIVPNVWR
PLPDWLGNEQPYDLNSWKESDAGLRLADTLDEDAVIVEGYAEYATWRPHLAYLRDPFGDI
HVEMELDGIGGVSILAKAAVFRHGAHFPAFSFQKHAETEGFGKMCKRMGMSVVGLPHYTI
WHIYEPSDDDLRHMEWMAQQDELREKERVLKEAHDKVWQSGFDNVKQEWERERELILKNV
ELDFDVHQKVRAKKAEEQSKAEAKVHGPEEEKVVPGVGKAALQPDAVKKVVQG

Enzyme Prediction     

No EC number prediction in YALI1_C05264g-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	69	331	1.3e-123	0.9850746268656716

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	3.53e-163	69	331	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW02309.1|GT62	0.0	1	473	1	473
QNP96414.1|GT62	0.0	1	473	1	473
CAG81720.1|GT62	0.0	8	473	1	466
CAG25432.1|GT62	0.0	8	473	1	466
ANB11737.1|GT62	3.03e-203	54	423	76	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.81e-55	70	365	6	302	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	7.26e-189	27	421	15	413	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	9.42e-155	7	402	19	409	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|Q00314|VAN1_CANAX	2.26e-127	64	374	70	430	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P23642|VAN1_YEAST	8.54e-126	69	374	171	523	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|P53697|MNN9_CANAL	1.24e-65	62	365	65	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000007

TMHMM  Annotations     

Start	End
24	46