CAZyme Information: YALI1_B20378g-t41_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI1_B20378g-t41_1-p1
• CAZy Family: GH132
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515		54593.66	4.2398

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB89W29	8746	N/A	797	7949

• Gene Location: location=CP017554:2037842-2039389(+)

Full Sequence      

MKLSTLVLAALTAVAVADDYKSISCDVDNHCPEDKPCCSQYGECGTGAYCLGGCDPKSSF
ELKSCMPMPVCKKRQSKFTSMDRIAKNTEYLGDAENFDWVYTGNLIQQNNGLLLTMPKNS
VGTVLSSTDYMWYGKVSATFKSSHLQGVVSAFILFSDVKDEIDYEFVGADVNTVQTNYYW
QGVLDWTHGINISVDNTHENFFTYSIDWTPDQITWAVDDQPGRVLKKSDTWDEKTKSYMY
PQTPSRIQLSLWPAGQASNAEGTIAWAGGEIDWDAEDIQKYGYYYATVTEIDVDCYDPPA
SAKKSGDKSYRYTDLNAMEADVEITGDDTVLASFDATGADPEKDDGSKNGTAPTGMMQHP
DNDPNIANVTGGVAASTKKTTSVASSTESLEDVSGSAIKKSTSSKESTSSDADPTEVVSG
ERVSSKETSSASASSGNNNGGNNNNGGNSGSAAATGSSSRNPQGNAATASNTGNGGFQQF
GQASGSAAEKANTAGSNGMSSLLLAGALAAASLLM

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	101	272	2e-78	0.9885057471264368

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	1.91e-96	88	297	1	203	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	1.26e-56	102	268	3	168	Glycosyl hydrolases family 16.
211314	ChtBD1_GH16	5.86e-29	23	69	1	47	Hevein or Type 1 chitin binding domain subfamily that co-occurs with family 16 glycosyl hydrolases. This subfamily includes Saccharomyces cerevisiae Utr2p, also known as Crh2p, which participates in the cross-linking of chitin to beta(1-3)- and beta(1-6) glucan in the cell wall, and S. cerevisiae Crr1p, a putative transglycosidase which is needed for proper spore wall assembly. ChtBD1 is a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
225182	BglS	4.43e-20	29	281	16	265	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185684	GH16_lichenase	1.06e-18	108	253	37	184	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG83185.1|CBM18|GH16_19	0.0	1	515	1	515
QNP96784.1|CBM18|GH16_19	0.0	1	515	1	515
AOW01749.1|CBM18|GH16_19	0.0	1	515	1	515
CAP94650.1|CBM18|GH16_19	2.93e-139	6	340	8	342
CAK39569.1|CBM18|GH16_19	9.93e-138	4	376	6	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	4.20e-32	111	314	48	234	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
5SV8_A	1.11e-09	159	281	87	196	Crystal Structure of the catalytic nucleophile and surface cysteine mutant of VvEG16 in complex with a xyloglucan oligosaccharide [Vitis vinifera]
5DZE_A	4.92e-09	159	281	86	195	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with cellotetraose [Vitis vinifera]
5DZF_A	5.00e-09	159	281	87	196	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a mixed-linkage glucan octasaccharide [Vitis vinifera],5DZF_B Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a mixed-linkage glucan octasaccharide [Vitis vinifera]
5DZG_A	5.07e-09	159	281	88	197	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a xyloglucan tetradecasaccharide [Vitis vinifera],5DZG_B Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a xyloglucan tetradecasaccharide [Vitis vinifera]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WI46|CRF2_ASPFU	8.62e-144	4	340	6	345	Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf2 PE=1 SV=1
sp|P32623|CRH2_YEAST	3.75e-124	25	343	27	349	Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTR2 PE=1 SV=3
sp|Q5AJC0|UTR2_CANAL	1.05e-121	1	345	1	359	Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTR2 PE=1 SV=1
sp|Q05790|CRR1_YEAST	1.02e-65	15	296	18	354	Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRR1 PE=2 SV=1
sp|Q75A41|CRR1_ASHGO	8.06e-65	6	297	9	363	Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=CRR1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000200	0.999793	CS pos: 17-18. Pr: 0.9736

TMHMM  Annotations     

There is no transmembrane helices in YALI1_B20378g-t41_1-p1.