CAZyme Information: YALI1_B18572g-t41_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI1_B18572g-t41_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609	CP017554|CGC11	67583.08	5.1845

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB89W29	8746	N/A	797	7949

• Gene Location: location=CP017554:1857257-1859086(+)

Full Sequence      

MSDDKHTFDFIIVGGGTAGPTLARRLADAWISGKKLKVLLLESGPSSEGVDDIRCPGNWV
NTIHSEYDWSYEVDEPYLSTDGEERRLCGIPRGHCLGGSSCLNTSFVIRGTRGDFDRIEE
ETGAKGWGWDDLFPYFRKHECYVPQGSAHEPKLIDFDTYDYKKFHGDSGPIKVQPYDYAP
ISKKFSESLASFGYPYNPEIFVNGGAPQGWGHVVRSTSNGVRSTGYDALVHAPKNLDIVT
GHAVTKILFEKIGGKQTAVGVETYNRAAEEAGPTYKARYEVVVCCGSYASPQLLMVSGVG
PKKELEEVGVKDIILDSPYVGKNLQDHLICGIFVEIKEPGYTRDHQFFDDEGLDKSTEEW
KTKRTGFFSNPPQGIFSYGRIDNLLKDDPVWKEACEKQKALNPRRDPMGNDPSQPHFEIW
NAELYIELEMTQAPDEGQSVMTVIGEILPPRSKGYVKLLSPDPMENPEIVHNYLQDPVDA
RVFAAIMKHAADVATNGAGTKDLVKARWPPESKPFEEMSIEEWETYVRDKSHTCFHPCGT
VKLGGANDKEAVVDERLRVKGVDGLRVADVSVLPRVPNGHTQAFAYAVGEKAADLILADI
AGKDLRPRI

Enzyme Prediction     

No EC number prediction in YALI1_B18572g-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	598	2.8e-152	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.02e-92	1	601	1	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.30e-90	6	608	4	539	choline dehydrogenase; Validated
274888	Rv0697	9.86e-64	9	597	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	7.36e-38	450	592	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.38e-36	6	603	54	583	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW01674.1|AA3_2	0.0	1	609	1	609
QNP96753.1|AA3_2	0.0	1	609	1	609
QRC90540.1|AA3_2	3.74e-142	3	599	10	580
BCS07163.1|AA3_2	5.64e-138	5	596	2	565
QKX55584.1|AA3_2	1.81e-135	2	596	5	584

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.92e-74	2	599	2	572	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.69e-74	2	599	2	572	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	3.75e-74	2	599	2	572	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.51e-73	8	599	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	8.19e-73	8	599	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0B2F7|BETA_BURCH	3.54e-60	8	596	6	532	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain HI2424) OX=331272 GN=betA PE=3 SV=1
sp|B1K707|BETA_BURCC	3.54e-60	8	596	6	532	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain MC0-3) OX=406425 GN=betA PE=3 SV=1
sp|Q1BQE2|BETA_BURCA	3.54e-60	8	596	6	532	Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain AU 1054) OX=331271 GN=betA PE=3 SV=1
sp|A4JJG6|BETA_BURVG	4.91e-60	8	596	6	532	Oxygen-dependent choline dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) OX=269482 GN=betA PE=3 SV=1
sp|Q3JLL7|BETA_BURP1	6.67e-60	8	596	6	532	Oxygen-dependent choline dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) OX=320372 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in YALI1_B18572g-t41_1-p1.