CAZyme Information: YALI0_F14927g-t26_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI0_F14927g-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: YALI0F14927p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
790	CR382132|CGC7	90061.14	5.1518

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB122	7223	284591	775	6448

• Gene Location: location=CR382132:1994834-1997206(+)

Full Sequence      

MHFSTVIVAALTLLVVNAASNDTLLWGPYRPNLYFGVKPKLRESLLSGLMWFNADSFNHI
HTIRHECEQGDNMASFGWHEYDSRLGGRQLIEDVNHDVDITTEFVTSEDGESWGVRVSGK
RRQKKDGITSLVFYSGLEGKGDLNGPTPSAKGYKDIVELEGNSPDLGQFTVTITEKGKKN
VHPDEDHPIAEKMIMDNLQHASLKVPTGNVWKAKGVFLTLLQERIARLSEKYPETDQVPA
AWVLQVEDQGMKGNLHFVQLTFEGDFEFDVLYNTKGAMLQLNSENLSEEISRNSEIFNTK
FDSIFPVNAPFDTPKHAIFAKNMFSNLLGGVGHFSGSSLVNRKASEEYDEDEERFWEGAT
HSSSAVGEEEGPFELLTTVPSRPFFPRGFYWDEGFHLIPVLEYDSDVALNILDSWMNLMD
EDGWIAREQILGPEARSKVPAEFQVQFPHYANPPTLLLLISRAIEKFESHQRGETARQVR
DQYATEYSLGDSLISSPEKFAAFLEKLYPKLQLHFDWFRTTQKGEVKEWDREAFSKREGY
RWRGRTKTHCLTSGLDDYPRAETPHAGELHVDLLSWIGLMARSLKDVAQFLDKPADVKKY
AKIENAIVQNLDDLHWSEDEQAYCDATIDDYEENAHVCHKGYVSLSPFFLKHINPKSEKL
PAVLDLISDPNELWSDYGLRSLSKSSPLFGTNENYWRGPIWMNINYLVLDALKHYGENPE
VDPKVRKQAADIYYKLRQNTVKNVHKQWKKTGYGWEQYNEETGAAQGVKHFTGWTSLVVS
IMGMPEKLDV

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	567	782	4.8e-38	0.43333333333333335

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	281	784	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	4.29e-90	24	239	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	1.12e-06	487	717	346	553	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	1.71e-06	571	776	578	773	alpha-glucosidase; Provisional
283786	GDE_C	0.002	487	701	91	300	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW07198.1|GH63	0.0	1	790	1	790
CAG78244.1|GH63	0.0	1	790	1	790
QNQ00752.1|GH63	0.0	1	790	1	790
ANB14481.1|GH63	5.61e-302	20	788	67	834
CAP86599.1|GH63	2.79e-279	19	786	38	811

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	1.97e-204	20	783	11	801	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	4.40e-114	17	782	30	775	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	9.26e-232	16	782	34	804	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	2.02e-203	20	783	41	831	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q84M89|GCS2_ARATH	3.06e-117	21	782	43	782	Alpha-glucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=GCS2 PE=2 SV=1
sp|F4HTM3|GCS1_ARATH	2.76e-116	21	782	106	845	Mannosyl-oligosaccharide glucosidase GCS1 OS=Arabidopsis thaliana OX=3702 GN=GCS1 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	2.00e-114	17	782	85	830	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000194	0.999781	CS pos: 18-19. Pr: 0.9822

TMHMM  Annotations     

There is no transmembrane helices in YALI0_F14927g-t26_1-p1.