CAZyme Information: YALI0_F04169g-t26_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI0_F04169g-t26_1-p1
• CAZy Family: GT35
• CAZyme Description: YALI0F04169p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
888	CR382132|CGC4	101931.15	6.1591

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB122	7223	284591	775	6448

• Gene Location: location=CR382132:632421-635087(-)

Full Sequence      

MSQDQRTSYRAGAGSDPFLRSRSPSHERMMGQESPIQPLNRHRRTFTGFTQRQIEHIDNT
IPLESRQIWKKFSLGEFGDKQEFQQEFVRHVETSLARSLYNCDDLAAYQAASQAVRDRLV
VAWNRTQQKHTLTDTKRVYYLSLEFLMGRALDNAMLNTRTKQYAREGVKDFGFRLEDLIE
QEPDAALGNGGLGRLAACFVDSLASENYPGWGYGLRYEYGIFKQKIIDGYQVEQPDYWLT
YGSSWEIPRNEISVDIMFYGYVRHYTDDEGVHRRCWEGGDVVRAVASDFPVPGYGTANVN
NLRLWSSKPAQEFDFAKFNAGDYINSVSEQQRAETISAVLYPNDNFDSGKELRLKQQYLW
VAASLNDIVRRFKKSKRPWREFPEQIAIQLNDTHPTLAIVELQRIFVDLEQLPWKEAWDL
VVETFGYTNHTVLPEALEKWPVPMLENLLPRHLEIIYDINLYFLQEVEAKFPNDRELLSR
VSIIEESQPQQARMAYLAIIGSHKVNGVAELHSDLIKKTIFKDFVAVYGGDKFINVTNGI
TPRRWLHQANPELSDLIASKIGSGFVKDLSELRHLEKFADDEDFQRQWMLVKHKRKEKLA
ALVKSQSGVVLNPDHLFDIQVKRIHEYKRQQLNILGVIHRYVELKQMSPEERRKMTPRVS
LFGGKSAPGYYMAKTIIKLINDVGKVVNNDPDMFDSLKVVFVEDYNVSKAEIIIPASDIS
EHISTAGTEASGTSNMKFVLNGGLIIGTVDGANVEITREIGEDNIYLFGHLADEVEDIRH
KHKYGGVQVGKKLQQVFDFIQSGALGDPEIYTSLLHSIKYGGDYYLVSDDFDAYLEAQHT
INHDFKDTKEWARKSIVSVSRMGFFSSDRAIRDYAEGIWNVEPSPVEE

Enzyme Prediction     

EC	2.4.1.1:158

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	168	882	2.4e-276	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184948	PRK14986	0.0	114	883	48	812	glycogen phosphorylase; Provisional
223136	GlgP	0.0	79	883	5	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
237881	PRK14985	0.0	79	879	6	794	maltodextrin phosphorylase; Provisional
273967	P_ylase	0.0	87	881	1	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
340853	GT35_Glycogen_Phosphorylase	0.0	84	881	1	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW06640.1|GT35	0.0	1	888	1	888
CAG77789.1|GT35	0.0	1	888	1	888
QNQ01362.1|GT35	0.0	1	888	1	888
ANB12790.1|GT35	0.0	35	886	36	888
CDR38466.1|GT35	0.0	38	883	21	868

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YGP_A	0.0	44	883	5	877	Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae],1YGP_B Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae]
3CEH_A	2.04e-268	82	884	4	808	Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEH_B Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEJ_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEJ_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEM_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens],3CEM_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens]
1FA9_A	7.18e-268	82	884	26	830	HUMAN LIVER GLYCOGEN PHOSPHORYLASE A COMPLEXED WITH AMP [Homo sapiens]
1FC0_A	7.18e-268	82	884	26	830	HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],1FC0_B HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],2ATI_A Glycogen Phosphorylase Inhibitors [Homo sapiens],2ATI_B Glycogen Phosphorylase Inhibitors [Homo sapiens]
1XOI_A	7.18e-268	82	884	26	830	Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens],1XOI_B Human Liver Glycogen Phosphorylase A complexed with Chloroindoloyl glycine amide [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06738|PHSG_YEAST	0.0	33	883	15	900	Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
sp|Q00766|PHS1_DICDI	5.91e-312	38	887	6	846	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
sp|P34114|PHS2_DICDI	2.11e-293	79	886	110	916	Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
sp|P06737|PYGL_HUMAN	3.82e-267	82	884	27	831	Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL PE=1 SV=4
sp|Q9XTL9|PYG_DROME	4.89e-267	74	884	19	831	Glycogen phosphorylase OS=Drosophila melanogaster OX=7227 GN=GlyP PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000000

TMHMM  Annotations     

There is no transmembrane helices in YALI0_F04169g-t26_1-p1.