CAZyme Information: YALI0_E34155g-t26_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI0_E34155g-t26_1-p1
• CAZy Family: GT34
• CAZyme Description: YALI0E34155p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677	CR382131|CGC2	73503.01	4.5893

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB122	7223	284591	775	6448

• Gene Location: location=CR382131:4056932-4058965(+)

Full Sequence      

MKFTTLLSMASVAMSAAVTVEIHSTVLETVFETASETIISDAATPEPSPTVRYVTILPKP
FPAFNGVALSGTVHNKRDTVETSVDCNLGLASASAAALREQSSAGTSSAAYTATLTSGSN
LSSETHTIEVSSSTSSIPEPATASIETEPNPSLIPLFIPVHQEDSTTDTTTDTHNMGLGT
KIRDMVNNVGPVAAADLSKPNQAPNDRTIFQSRNNHGPNIGSMFLLEKWLTPGMFPDSAK
GDAELDAVTALVAEQGAGGAQKKFEDHWNTWITDDDFSYLQSVGANAIRVPMGYWTINGG
AFTQGTPFQQYQSVYQNAWSIFKTNILDKARAANIAVLIDLHAVPGGANGDAHSGTSSGK
VEFWDSRSDQKIAIDALQWVAKDVLSYDNVLGIEVVNEAVYDASTSKEGSYYLRALEAIR
QVNPDVPVYISDGWAPTEWNEWVQEQNQKLSAGQNTGFVVDSHVYKAFSEQDKGNSPQQN
IANVPAYLNVGKAQADSIVGEFSCVFSEETWAKAGGEDREQLAIKYGQVQIESFNQNARA
GWFFWTYKFQYGDGGDWGFKPMTQKGALPTFSNGGSNKDPKAGIKEAATKATEEHSAYWD
QHQGNYEHWRYADGYVSGWQDAAAFYEFHGSTIGRINAWQDARRAQHIAAKGNSGAIWEW
DQGFDAGIQGLLNYMRS

Enzyme Prediction     

EC	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	263	555	2e-117	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	6.81e-25	213	556	16	326	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.10e-06	271	547	24	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNQ00916.1|GH5_49	0.0	1	677	1	677
CAG80367.1|GH5_49	0.0	1	677	1	677
AOW06372.1|GH5_49	0.0	1	677	1	677
ANB11837.1|GH5_49	1.39e-154	176	677	1	516
AEZ66642.1|GH5_49	5.38e-147	193	668	18	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.82e-25	217	569	11	379	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
4M80_A	2.62e-25	217	569	16	384	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]
1CZ1_A	3.30e-25	217	569	11	379	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
3N9K_A	3.53e-25	217	569	16	384	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
2PB1_A	3.58e-25	217	569	17	385	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38081|YBQ6_YEAST	2.70e-101	208	674	39	501	Uncharacterized glycosyl hydrolase YBR056W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YBR056W PE=1 SV=1
sp|O74799|EXG3_SCHPO	1.29e-76	205	676	4	462	Glucan 1,3-beta-glucosidase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg3 PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	6.59e-34	217	570	44	404	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	5.60e-33	217	570	44	404	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|A2RAR6|EXGA_ASPNC	7.60e-33	210	570	37	404	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001441	0.998507	CS pos: 17-18. Pr: 0.7958

TMHMM  Annotations     

There is no transmembrane helices in YALI0_E34155g-t26_1-p1.