CAZyme Information: YALI0_E33539g-t26_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI0_E33539g-t26_1-p1
• CAZy Family: GT34
• CAZyme Description: YALI0E33539p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414		42488.69	4.4164

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB122	7223	284591	775	6448

• Gene Location: location=CR382131:3985501-3986745(+)

Full Sequence      

MKFSTLALAAMAAIGFAAPATPDADCNEEKEVRDFHAHHQHKRAVQVEYVYVTVLVDGNG
NTIEQQQIATTELQEAPSPAPATSTQEAAPAPSSTLVAAFAAKEPVTQEASSAASSAAPS
STSAPKSSSAPSKPSNGGSGGITGDLAAFSGPSEKFQDGTIDCGDFPSGQGVIALNQLGF
GGWSGIYHPGSTATGGNCAEGAYCSYACQSGMSKTQWPDEQPANGVSVGGLLCKGGKLYR
SNQQSDYLCEWGTQSAIVTSSLDKEVAICRTDYPGTENMVIPTVVEAGSSGVPLAVVNQD
AYYTWMGKPTSAQYYVNNAGVSYQDGCLWGTSSGDVGNWAPLNFGAGAAGGISYLSIIPN
PNNRNSANFNVEIIATNGATVNGKCVYENGKYNGGDSNGCTVAVTGGVAAFHLY

Enzyme Prediction     

No EC number prediction in YALI0_E33539g-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	112	414	1.6e-121	0.976897689768977

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	3.40e-138	158	401	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG80339.1|GH132	1.70e-243	1	414	1	414
AOW06344.1|GH132	1.70e-243	1	414	1	414
QNQ00901.1|GH132	1.70e-243	1	414	1	414
QEL61839.1|GH132	4.05e-141	137	414	85	360
QRG39705.1|GH132	1.13e-140	137	414	115	390

PDB Hits     

YALI0_E33539g-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59NP5|SUN41_CANAL	1.36e-133	141	414	146	417	Secreted beta-glucosidase SUN41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUN41 PE=1 SV=2
sp|P53616|SUN4_YEAST	3.82e-131	139	414	146	419	Probable secreted beta-glucosidase SUN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUN4 PE=1 SV=1
sp|P40472|SIM1_YEAST	3.35e-130	142	414	205	475	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2
sp|B3LRC2|UTH1_YEAS1	1.85e-109	153	414	103	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1
sp|A7A003|UTH1_YEAS7	1.85e-109	153	414	103	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=UTH1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000190	0.999777	CS pos: 17-18. Pr: 0.9732

TMHMM  Annotations     

There is no transmembrane helices in YALI0_E33539g-t26_1-p1.