CAZyme Information: YALI0_E31086g-t26_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI0_E31086g-t26_1-p1
• CAZy Family: GT32
• CAZyme Description: YALI0E31086p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1049		117019.95	6.4348

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB122	7223	284591	775	6448

• Gene Location: location=CR382131:3662611-3665847(+)

Full Sequence      

MTLIVVSLFLPYTINFNLDEGQRPKVDVTTEPVAPSRPPISRSNSDLKTLPTVPKSGGVS
ALTLALERFPQEKPSQQNSGGSSLTSSVTQTPNPALPSMFHKAEPTGPAPAIVHPDEFFK
PSPHAQASAIVQPPSAVAGALQVSSAGSPQQAGFLENELALQKMKHPTVPPSASEPSSVS
SANSNPAEYPTLRPPRPQYNQPQSRASSPPPRVVDKRRPVSGQTAMRFIDRFGQQKPSDS
FQSAKDWTVEKSHKGNGGLRNAVNRYCASTNHKKLWVGTLGMPSDELGDVSKVEIERKLT
REYDSVPVFAPDNTFEAHYTHYCKGILWPTLHYQTPDSDKSKAYHDHSWEHYKALNQMVA
DKVIEVYKRGDVIWIHDYHLLLVPEMVRQQLPNARIGMFLHVTFPSSEVFRCLAARNELL
TGMLGATCIGFQTAEYGRHFLQTCNRLLVVDASVDGVENNDGRFTAVVACPIGIDPPSLQ
KHFMDPEVDKWRRLIRARWPGKRLLVSRDKLDSLRGIKQKLLAYEHFLINNREFCDNVVL
VQVCLSGNESDSLEGELVHIMDRINALTDDLSNQQVIFLHQDIEFEQYLAMLAEAEAYVA
LSLREGMNLTCHEFILCSKDNSGQLILSEFTGSASVLDNDDVLVVNPWNMRQVSDAYKTA
LTMDRGTREKHRGRLVEFVEGHTCLQWATTFLQHLEDAWVEHQKSKRLLPRLNIAYAKER
YDIVAKQPGKYRLFLLNLEGRDFSSPHTSKPALSSSAAVYSSTHNRIPILTELVSDPYNV
VYIISSDARHDIERLFRNVPNLGIIAENGGYLRPYRSDQWIRMCDEEDVHNWKDSVLEVL
ESIKERCPGSSIKSDETTITFQFTPQYSAEQEQDFSFDFAGECVSHINDAFSTQNITARF
NDDRILVENQQLSRLAAVKRAVAIFEKTCKIGGDIESKGINSGHLTVAPSSPTLTRTRSY
TISAPGPSYDATISYVFVAGNDQSDYPVIEWANSLGDVETVLTVGLHSEHSPAAVSVEGL
NGLTLALRELAVGDRSDIKGDRDTRERTP

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	242	696	3e-145	0.9389473684210526

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	248	696	19	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	1.09e-165	246	697	23	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	7.66e-145	226	698	15	480	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
184712	PRK14501	1.35e-130	257	863	28	612	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215555	PLN03063	1.38e-108	204	863	6	632	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW06212.1|GT20	0.0	1	1049	1	1049
QNP99303.1|GT20	0.0	1	1049	1	1049
CAG80223.1|GT20	0.0	1	1049	1	1049
ANB15343.1|GT20	7.34e-215	247	1023	120	908
ATZ46284.1|GT20	9.27e-207	1	1031	1	920

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	2.45e-87	248	695	12	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	7.23e-87	248	695	24	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVO_A	3.43e-84	257	695	39	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5DXF_A	1.36e-80	287	705	114	534	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5HUT_A	8.71e-76	257	695	32	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38427|TSL1_YEAST	5.00e-172	229	917	328	983	Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSL1 PE=1 SV=1
sp|P38426|TPS3_YEAST	8.67e-167	247	917	314	948	Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS3 PE=1 SV=3
sp|Q9UUI7|TPSY_SCHPO	1.22e-146	197	1013	110	874	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|O14081|TPSX_SCHPO	2.49e-146	249	917	202	866	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|Q54K57|TPSA_DICDI	8.84e-97	242	863	32	624	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.841120	0.158882

TMHMM  Annotations     

There is no transmembrane helices in YALI0_E31086g-t26_1-p1.