CAZyme Information: YALI0_E20185g-t26_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI0_E20185g-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: YALI0E20185p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
857		94174.28	6.6260

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB122	7223	284591	775	6448

• Gene Location: location=CR382131:2394733-2397306(+)

Full Sequence      

MEELSEAERNQIGQLFICGLRNAELDEDIAELVRTFKVGSIQVSIKNLPSVDQARELIRG
VQQLAYEAGHEQPMAICIDQEGGILNNLKGVTQFPCQMALAASKDTDLVEAVAEAAAKEL
LACGINFMFAPCMDVLKSTSASADFLLGTRAFGDDHEIVSQFGCAFLRGLQKQNMMACGK
HFPGYGTASLDSILGGVPVVSDNELQMQAQAFVPFKAIIDMDCDAIMVGGCSAPGLDPTE
AHACLSWKICTDILREQLGFKNVIVSECLEMEALYQQVGVKQGTVSAKLAGCDMILCCSS
FKLQKQALEGLSGAYLDGLVEPESIMASAERVRHMKSSRNLTWQSILGERPFVAELLQEH
KLLSARAYESCVAIGRDYLHMIPFSLKRSDTILLLTPLCESDDIHSGRCTPAQTNGNGNP
SNVRLLPGEATFQHLGKTIASYHTGKTLHTSYSQNGIIKLHEQLIARATVVILVNTTAYS
NMYQTSITKYVQLLCDQRRIPFVLVAASSPHDMASSNHTSDTKTYVCAFEFTPEMQVTCA
KVMFGKLPALGTIPFSHFWGRQRSGSKSLSTTSTRKTWMVETYAGENVQPLWDLCFPKRK
LPTEAFSVLNDIDCYVVKNSSTGKLYGFCAAHKTQVALLMVDPSRRKMGIAVSLYKRVQR
AKGRKDPSAAQLTSFGSVLPAYFAGATPESLAWLQKVDRAMIFRDNVVVLVNQRLQDFRV
DAAVIQELQQNNLRFSIASVAETDAKDLPEELRESDAYVAQCLKDGSVVGSVVLFNKGSS
IARWLPWIYEFGPSVGGMTSLRCDSDLIMQGLVCCAMRSFRIEGFQTVVLDHMSVAQRDS
LSGLGFSVWRVEEKFSR

Enzyme Prediction     

No EC number prediction in YALI0_E20185g-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	72	296	3.3e-59	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.06e-58	11	401	6	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	4.05e-55	9	332	3	313	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.01e-32	24	344	12	314	beta-hexosaminidase; Provisional
185053	PRK15098	9.98e-13	1	294	42	317	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW05688.1|GH3	0.0	1	857	1	857
QNP99091.1|GH3	0.0	1	857	1	857
CAG79772.1|GH3	0.0	1	857	1	857
ANB11221.1|GH3	2.14e-169	12	850	20	955
UJO20030.1|GH3	1.51e-134	12	856	19	920

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	4.17e-61	11	850	12	851	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.98e-50	9	554	14	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.64e-42	11	515	47	570	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.20e-42	11	515	21	544	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.17e-42	11	515	51	574	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	8.45e-42	11	515	47	570	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|A7MFT1|NAGZ_CROS8	8.69e-30	24	361	12	338	Beta-hexosaminidase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=nagZ PE=3 SV=1
sp|B2FPW9|NAGZ_STRMK	8.65e-29	15	317	1	296	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
sp|B4SRK3|NAGZ_STRM5	8.65e-29	15	317	1	296	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
sp|C4LEY6|NAGZ_TOLAT	1.55e-28	20	346	8	312	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in YALI0_E20185g-t26_1-p1.