CAZyme Information: YALI0_D25938g-t26_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI0_D25938g-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: YALI0D25938p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1063	CR382130|CGC4	118387.01	6.1588

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB122	7223	284591	775	6448

• Gene Location: location=CR382130:3447307-3450498(+)

Full Sequence      

MTERYYANDNRSHDHLTDRFATPHPAPTPHGGHPTEELADHYGFSAPGNNNYAPATPAPP
LPPNPYHNGVHSSAPTAPLDFPEQPGADDHHDLGHSAHQNDPLTQDTSYYGAGTGVPPAD
PYGPDPYAPAPDAHFYENNAIPAVGGANLYQQNSYQHDPAPFVPEEGDSYLLKPYGQQQH
HSLGVFDNGSYVNDEADLDNFVPFPIAGDTYALNTYEDSEEEEPPVQMPDSFAGSRRSFE
SGDDDDDDDDDDDDETIEEPSAFGAHVPPPDVQPRRRKTIKRVRLFRGNLVLDCPVSKKL
LSKYPEPRREREFTHMRYSAATCDPSEFVPNQFTLRQKCYQQPRQTELFIVVTMYNEDDI
LLGRTLQGVFKNIKHLTTRTRSKVWGKDAWKKVVVCVVSDGREKINPRARALMAALGVYQ
DGFAKNIVNDQPVAAHIYEYTTMVGISSVDKSVKLTTEKTIPIQMVFCLKEKNQKKINSH
RWFFQAFGPVLNPNVCILLDAGTQPGHDSIYHLWKAFDSHADVGGACGEIKAMLGKGGKQ
LLNPLVAAQNFEYKMSNILDKPLESVFGFISVLPGAFSAYRYTALQNDVNGVGPLASYFK
GETLHDSGAGIFTANMYLAEDRILCFELVAKKNCSWKLKYVKSSSAETDVPDHLSELVMQ
RRRWLNGSFFAAIYSSAHFYQIWRSSHSIGRKLFFHLEFIYQTFQMLFSWFAIGNFFLVF
RILTSALGDPSMHFAPGNVLGVVFLWLYCCCIVATFVLAFGNRPTGTQAFYTVVVCFFAV
LMAYLIFAAIYISVKAVSYALCSNGGKLTLSLVFTNATFRDLVVSLCSTYALYFLMSFLY
FEPWHMFTSFLQYLLISPSYINVLNVYAFCNIHDISWGTKGDTAQKMDLGVAKTNQAGKL
EVDIPTQELDIDSSYMNEINTLQQVVKEEKRQPSKEDKETDYYALVRSSVVLFWMLTNFV
VIAVVLNAGGLSIVSTDPAQAAGAAAPAGAGAAAVAPALRFVRRGIRHVLETRQDPGTCE
AVGGPTDVRTEIYLRVVLWSVAALSCFRGIGATWYLIARLFGH

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	354	517	1.3e-74	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.78e-106	354	517	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	2.08e-94	350	671	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	3.24e-37	282	353	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	3.25e-32	466	884	115	426	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	6.19e-17	350	585	1	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG81500.1|GT2	0.0	1	1063	1	1063
QNP98107.1|GT2	0.0	1	1063	9	1071
AOW04661.1|GT2	0.0	1	1063	9	1071
ANB10975.1|GT2	0.0	163	1063	189	1103
EGX50517.1|GT2	0.0	118	1061	78	968

PDB Hits     

YALI0_D25938g-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30583|CHSC_EMENI	1.37e-310	136	1061	67	915	Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsC PE=3 SV=3
sp|P30601|CHS2_EXODE	2.52e-308	142	1060	66	917	Chitin synthase 2 OS=Exophiala dermatitidis OX=5970 GN=CHS2 PE=3 SV=2
sp|P30588|CHS3_NEUCR	2.90e-307	121	1061	35	885	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2
sp|P30572|CHS2_CANAX	4.21e-301	132	1060	109	997	Chitin synthase 2 OS=Candida albicans OX=5476 GN=CHS2 PE=2 SV=2
sp|Q12564|CHSA_AMPQU	1.41e-297	268	1060	150	898	Chitin synthase A OS=Ampelomyces quisqualis OX=50730 GN=CHSA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000085	0.000000

TMHMM  Annotations     

Start	End
703	725
738	760
770	792
822	841
851	873
944	966
981	1003
1036	1058