CAZyme Information: YALI0_D19602g-t26_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI0_D19602g-t26_1-p1
• CAZy Family: GH76
• CAZyme Description: YALI0D19602p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
691		76268.27	6.9837

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB122	7223	284591	775	6448

• Gene Location: location=CR382130:2485855-2487930(+)

Full Sequence      

MYKAKTFSELVFQATPSDQPWQQNNISPATRTAFPVRIHKTEGTVAGATSLCQPRDQPSS
QSFHTLHSPKNNSSRDTNLGSCLFTSADSLITFDFGQNICGVVTLKFGPRSSKTILGLAF
SESSDFVGRNSDKSVDFKVTDGHVTVEVYPGISEYTMPVEKLRGAFRYLTVFVASKTRDC
IAHVTSVSCNMTQMPSSASLNKYSGFFHSSDPLLNKIWYAGAYTIQLATISSVQGRKSDY
VVKSRGWDNSGHVSQGLEVLTDGAKRDRSVWSGDRLISTSVYHCAFGGVNSAATATAIDW
IFAGQQPDGRLPYACKPADLYGSDTFHLWGLLGLYELWQHSGDFQRVRELWVPFKKGVEL
GMSWIDSDYGLAKIVCGLDWGRSVLQGHSLSLNVLLYACLVCSVEIGNLLGEPEAQLAIW
INTAESLHVRINELLWDAEKGLFKDNLSSTLYPQDGNCLVIYYGVCDSERSKTVSERLFA
RWNQFGPINPESNGMISTFISGIEVMAHHQAGRTLRALALIRQTWSYALSAPWSVESSLV
EGFYKDGTCSYPSDKHDSSYISHSHPWSTGPTSFLSYKICGLRFTNPNHVTWTLQPTLAD
LDFCITGFTSAKTGYLVGGWKRDSKNLLQIAVKSTPGTIGEICVPLILGKQLKMTVDGVN
VNLLNLEMDEGWAYVKGIEGGCHTVYAWYLD

Enzyme Prediction     

No EC number prediction in YALI0_D19602g-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	86	642	5.3e-75	0.9880952380952381

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	2.58e-10	205	527	4	299	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
395961	Trehalase	0.008	392	486	307	403	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG81231.1|GH78	0.0	1	691	1	691
QNP97971.1|GH78	0.0	1	691	1	691
AOW04326.1|GH78	0.0	1	691	1	691
QRV95788.1|GH78	1.99e-165	6	647	19	659
QRV81298.1|GH78	3.98e-165	6	647	19	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	3.75e-13	91	603	194	660	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	7.58e-08	85	575	90	538	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

YALI0_D19602g-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in YALI0_D19602g-t26_1-p1.