CAZyme Information: YALI0_C12661g-t26_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI0_C12661g-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: YALI0C12661p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1470	CR382129|CGC8	165684.55	4.7285

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB122	7223	284591	775	6448

• Gene Location: location=CR382129:1763760-1768814(+)

Full Sequence      

MKLLKYAAAALFASSVAANVTVELKAQWQSDFLLELVETLSTEHTYFDFINHIAEQVEDG
ANYTDKEWYDNLTAFAASKSEISDFQKSLTDAALAFRRESPLIETFYQLGDSQESECDIF
FTYNGKKYCDSNDLFTLKTTKMPKNPSVYFFDHVARSVQANKHLKNIPVTVLYADLRSPE
FPLFHKILYQEAQDGKMVYILRYRRSDRSERVTMTGYGAELSLKKTDYLVLDDDANTEKL
TDNKNPVYTKRELQNMGLNAAQFVLNHRKDPEAALKALKEVSFDFPLLSSSLNNTKPVKG
FQKALQENTAAGDFMPGANQMFVNGALLSTSASNLQSLFDLVALEHSRLEVLAKTLKGAI
SAEQLASILNDYPLQHALESQPQRIDYRDADALLWLNNLATDIQYQEWPRSVASLLQNQI
NLAHNAQTVVMPFNMDDFADVKVDKETGELINMHPINRGKLTVLFTMLQRSMPIQFGVVP
YGSTLKGKKLSQYLHYLARNVDATASLRFLFALGAGTPVEEIFTQIPAEITQESVDEALK
EESYEPYVTASREWMKKLGMNEAQTQEPAFVMNGIVMPFSEKWQNLVGARFQQDLPEMLK
LVQKQIIKVSKEAPVGEDDEDEDDENAGNPVDKYFANHEIKDLLVEGSPTRRNLILSPAS
FTNLQYLESDLNLKDVSTATIAGTTASIFSNSILAGNFASTQFVSQLLALIEAQQEEKDR
FAFRTQFVHIGQTDSAKGQVINGVVQKLTELAGEEQVSLLKDALAYLEGDNASFSAKKVP
FDKTITASEEVKYLKQFKTTESSTLLIIDGLVNDISSKAMLLDKSEVIALYEREAVRRLE
LTSVALSDLKLLTKSVENNLDLAKVHIPLAKIFYGDATEQESTLYDVRAFHHIRWNKDVS
SFVLGDESTSLVKIVAAVDVLSDGGQRLVSQIEAISKVTGVSVRVFPSPKAPDARQEPTL
PLKRFYRAHNSVVPEFDAEGAHKVPNLNFEGLPAQNLLTFGLDAPSSWIAMPADNTHDLD
NILLEEDSEDFVDASYSLQNILIEGSIIDITKNSYAPGTDLLLKSTLTGESSDTLVMSNL
GYFQLQAGPGLWELNLGPSASDVYETEHEVIIPVTDVLGPHISLSMERKKGKENVVVGAS
QDKAKLWSKLKKSTGVSTKKQADINIFTVASGHLYERFLSIMTASVMAHTDHTVKFWLIE
NFLSASFKAFLPHLAAHYGFEYELVTYQWPHWLRGQTEKQRQIWGYKILFLDVLFPQDLE
RVIFIDSDQIVRTDLYELVEMDLEGAPYGFTPMCDSRKEMDGFRFWKQGYWDTFLGDDLV
YHISALFVVDLKVFRAQQIGDRLRVHYHQLSADPASLSNLDQDLPNNLQRQVPIFSLPQD
WLWCETWCSDESLKTAKTIDMCNNPLTKEPKLDRARRQVPEWTKYDDEIRKLRKEAEGIE
GKKKEEEERAGPVEVEVEIDEPEADLHDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1164	1412	8.7e-131	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1164	1432	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	8.27e-178	1164	1412	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	1.50e-54	1164	1412	1	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408199	Thioredoxin_12	6.71e-38	32	211	4	184	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408201	Thioredoxin_14	2.07e-37	385	608	1	225	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG82081.1|GT24	0.0	1	1470	1	1470
QNP95811.1|GT24	0.0	1	1470	1	1470
CAD67998.1|GT24	0.0	1	1470	1	1470
AOW02772.1|GT24	0.0	1	1470	1	1470
QGA15584.1|GT24	5.94e-235	19	1434	27	1457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	8.57e-218	19	1432	10	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	1.68e-217	19	1432	10	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	8.98e-217	19	1432	10	1447	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	5.94e-178	19	1374	3	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	7.18e-176	19	1432	10	1213	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	1.83e-194	49	1429	54	1421	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	5.24e-175	14	1432	24	1507	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	5.70e-170	14	1452	38	1549	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	1.95e-169	20	1432	47	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	9.21e-165	20	1432	47	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000274	0.999662	CS pos: 18-19. Pr: 0.9424

TMHMM  Annotations     

There is no transmembrane helices in YALI0_C12661g-t26_1-p1.