CAZyme Information: YALI0_A20922g-t26_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI0_A20922g-t26_1-p1
• CAZy Family: AA6
• CAZyme Description: YALI0A20922p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406		46008.19	9.5441

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB122	7223	284591	775	6448

• Gene Location: location=CR382127:2246913-2248133(+)

Full Sequence      

MSLLTTKNVLLAAIALRVVFFYYGLYQDATMALRYTDIDYYVFTDAARFMANGLSPYERE
TYRYTPLLAWLLQPTTLWFSFGKAVFAAGDIVAGYAIIRVLKMQGVSDKKAALYSTVWLL
NPMVATISTRGSSEGLLGALIALLLWAVYAKQWVVAGFIAGFSVHFKIYPIIYIPTIIWA
MNDTNVKTNGGKRVSLVEQAFNFFTKERLLFGFSAALTFIALFSACYHYYGHEFLQHTYL
HHLSRTDHRHNFSPYSTLLYMVSSKAGQAAEEQALLPPPQTWAFVPQLLLSGIILPLSLA
KISMVKTMFLQTFVFVTFNKVCTSQYFMWYIVLLPFYFKDSKLMSPGRKVVSITFAVLWV
VAQALWIQQGYALEFLGRSTFMQLCYATLGFFVVNCFGIVLLVGDL

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	127	401	2.1e-91	0.9885496183206107

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.04e-72	4	403	6	415	GPI mannosyltransferase
252941	Mannosyl_trans	4.20e-51	127	397	1	253	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNP95333.1|GT50	4.44e-290	1	406	1	406
CAG84247.2|GT50	4.44e-290	1	406	1	406
AOW00953.1|GT50	4.44e-290	1	406	1	406
ANB15202.1|GT50	4.26e-151	4	406	121	515
QKX64577.1|GT50	1.21e-132	13	405	15	414

PDB Hits     

YALI0_A20922g-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I073|GPI14_GIBZE	1.75e-130	4	405	8	407	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	8.38e-127	12	405	14	409	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	8.40e-126	13	405	15	427	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	7.57e-125	7	405	9	420	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	1.37e-124	12	405	32	484	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000002	0.000009

TMHMM  Annotations     

Start	End
76	98
111	133
153	175
209	231
283	300
313	335
350	367
380	402
9	26