CAZyme Information: YALI0_A19888g-t26_1-p1

Basic Information

• Species: Yarrowia lipolytica
• Lineage: Ascomycota; Saccharomycetes; ; Dipodascaceae; Yarrowia; Yarrowia lipolytica
• CAZyme ID: YALI0_A19888g-t26_1-p1
• CAZy Family: AA4
• CAZyme Description: YALI0A19888p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411		46936.63	4.9400

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_YlipolyticaCLIB122	7223	284591	775	6448

• Gene Location: location=CR382127:2148129-2149364(-)

Full Sequence      

MSQNKLTDTNAEGLSIVEKAQKTFFNRGTYSSNPPCDGCYDDKGTFCVWPVAVFAQAVVD
GARIYPELKKLIPQAFEAFKPYETQEYPSVCTASKYFDGNKDIYFDDNAQIASAYITAYE
VTGEKSFLDKGRNIVRFLMTGYDSTGEPGGVRWHIGKTGSNACTTSESACAALRLSKYVP
NEASYYIDFARDCVKWVVHRLQDPEDWLIRDGVEYHDGQGFSVNDMKWTYNQGTTISALS
GLYGITNDQWYLKEAEKIIRGVCDPNTTIFDRDTQPEFRYYRDNVYFYQLLAEGFADFLL
FCGDDTDPKYAQLAVEQTKRNLVYIYQYLRDPKDGLYFQTFEIFRITPELAQEFDRLTGE
NRKFEPSEGERAKGKYEKEPVEKRPLVKTLLGQGGAARVFFQSARVVPKLN

Enzyme Prediction     

No EC number prediction in YALI0_A19888g-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	20	313	4.3e-58	0.7905027932960894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.02e-71	9	337	1	339	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	5.27e-07	104	262	91	244	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
224250	YyaL	1.93e-05	107	338	274	513	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG84200.1|GH76	2.68e-314	1	411	1	411
QNP95380.1|GH76	2.68e-314	1	411	1	411
AOW00907.1|GH76	2.68e-314	1	411	1	411
ANB13839.1|GH76	4.66e-112	8	411	4	404
AOW28251.1|GH76	4.27e-107	1	411	1	403

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	7.24e-15	98	265	125	292	Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.35e-13	98	265	126	293	Chain A, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	7.70e-13	98	265	126	293	An inactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4V1S_A	3.35e-11	102	256	139	291	Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4V1R_A	1.06e-10	12	256	52	291	Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1R_B Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14131|MU191_SCHPO	2.72e-71	12	411	9	418	Meiotically up-regulated gene 191 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug191 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000005

TMHMM  Annotations     

There is no transmembrane helices in YALI0_A19888g-t26_1-p1.